BLASTX nr result
ID: Rehmannia27_contig00011152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00011152 (507 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835972.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 80 3e-15 gb|EYU38498.1| hypothetical protein MIMGU_mgv1a001002mg [Erythra... 80 1e-14 ref|XP_011077405.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 74 6e-13 gb|EPS72127.1| hypothetical protein M569_02628, partial [Genlise... 70 6e-11 >ref|XP_012835972.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic [Erythranthe guttata] Length = 294 Score = 80.5 bits (197), Expect = 3e-15 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +2 Query: 362 CEIHHHDREFLHAPSSRWRLILRDYVSDSILKLSGFGGCSNGEILVQF 505 CE++ HDREFL AP SRWR++L DYVSDS+L+LS FGGCS+ EIL QF Sbjct: 120 CELYQHDREFLDAPPSRWRVVLSDYVSDSVLRLSSFGGCSSAEILTQF 167 >gb|EYU38498.1| hypothetical protein MIMGU_mgv1a001002mg [Erythranthe guttata] Length = 916 Score = 80.5 bits (197), Expect = 1e-14 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +2 Query: 362 CEIHHHDREFLHAPSSRWRLILRDYVSDSILKLSGFGGCSNGEILVQF 505 CE++ HDREFL AP SRWR++L DYVSDS+L+LS FGGCS+ EIL QF Sbjct: 742 CELYQHDREFLDAPPSRWRVVLSDYVSDSVLRLSSFGGCSSAEILTQF 789 >ref|XP_011077405.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic [Sesamum indicum] Length = 292 Score = 74.3 bits (181), Expect = 6e-13 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 362 CEIHHHDREFLHAPSSRWRLILRDYVSDSILKLSGFGGCSNGEILVQF 505 CE+H HDRE L +P S WR IL DYVS S+L+LS FGGCS+GE+L+Q+ Sbjct: 119 CELHQHDRELLDSPPSSWRAILCDYVSKSMLRLSSFGGCSSGEVLIQY 166 >gb|EPS72127.1| hypothetical protein M569_02628, partial [Genlisea aurea] Length = 875 Score = 69.7 bits (169), Expect = 6e-11 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +2 Query: 362 CEIHHHDREFLHAPSSRWRLILRDYVSDSILKLSGFGGCSNGEILVQF 505 CE+ HHDR+ L AP + WR ILR+++SDSILKLS FGGCS E L++F Sbjct: 712 CELQHHDRDSLGAPPALWRSILREFLSDSILKLSNFGGCSRTETLIRF 759