BLASTX nr result
ID: Rehmannia27_contig00008859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00008859 (928 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992319.1| hypothetical protein Salmi_Mp055 (mitochondr... 70 1e-11 >ref|YP_008992319.1| hypothetical protein Salmi_Mp055 (mitochondrion) [Salvia miltiorrhiza] gi|534292292|gb|AGU16584.1| hypothetical protein Salmi_Mp055 (mitochondrion) [Salvia miltiorrhiza] Length = 119 Score = 70.1 bits (170), Expect = 1e-11 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +1 Query: 1 DSVYMVELLRKRST*VPWRHLSMWRYTLQLLSHMNLVVSHIFREDNRATDILSKTPHEDT 180 DS+Y+V LLR RS VPW H + W YTL L+ MN+VV+HIFRE N D L+ + Sbjct: 32 DSIYVVSLLRSRSMIVPWNHRNRWLYTLHLIRQMNIVVTHIFREGNHVADALANAAGDLK 91 Query: 181 W 183 W Sbjct: 92 W 92