BLASTX nr result
ID: Rehmannia27_contig00008858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00008858 (394 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992319.1| hypothetical protein Salmi_Mp055 (mitochondr... 70 4e-13 >ref|YP_008992319.1| hypothetical protein Salmi_Mp055 (mitochondrion) [Salvia miltiorrhiza] gi|534292292|gb|AGU16584.1| hypothetical protein Salmi_Mp055 (mitochondrion) [Salvia miltiorrhiza] Length = 119 Score = 70.1 bits (170), Expect = 4e-13 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = -1 Query: 394 DSVYMVELLRKRST*VPWRHLSMW*YTLQLLSQMNLVVSHIFREDNRAAYILSKTSHEDM 215 DS+Y+V LLR RS VPW H + W YTL L+ QMN+VV+HIFRE N A L+ + + Sbjct: 32 DSIYVVSLLRSRSMIVPWNHRNRWLYTLHLIRQMNIVVTHIFREGNHVADALANAAGDLK 91 Query: 214 W 212 W Sbjct: 92 W 92