BLASTX nr result
ID: Rehmannia27_contig00007911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00007911 (544 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097915.1| PREDICTED: TBC1 domain family member 15-like... 57 2e-06 ref|XP_011095344.1| PREDICTED: TBC1 domain family member 15 isof... 57 2e-06 ref|XP_011095343.1| PREDICTED: TBC1 domain family member 15 isof... 57 2e-06 gb|EPS63483.1| hypothetical protein M569_11302, partial [Genlise... 53 7e-06 >ref|XP_011097915.1| PREDICTED: TBC1 domain family member 15-like [Sesamum indicum] gi|747099712|ref|XP_011097916.1| PREDICTED: TBC1 domain family member 15-like [Sesamum indicum] Length = 426 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 236 GTPADDYYQVRPECTDVPQSKFRIKMRETI 147 GTPADDYYQVRPEC DVP+SKFRIK +T+ Sbjct: 7 GTPADDYYQVRPECKDVPESKFRIKAGKTL 36 >ref|XP_011095344.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Sesamum indicum] Length = 443 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 236 GTPADDYYQVRPECTDVPQSKFRIKMRETI 147 GTPAD YYQVRPECTDVP+SKFRIK +T+ Sbjct: 6 GTPADSYYQVRPECTDVPESKFRIKAGKTL 35 >ref|XP_011095343.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Sesamum indicum] Length = 449 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 236 GTPADDYYQVRPECTDVPQSKFRIKMRETI 147 GTPAD YYQVRPECTDVP+SKFRIK +T+ Sbjct: 6 GTPADSYYQVRPECTDVPESKFRIKAGKTL 35 >gb|EPS63483.1| hypothetical protein M569_11302, partial [Genlisea aurea] Length = 145 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 236 GTPADDYYQVRPECTDVPQSKFRIKMRETI 147 GTPAD YYQVR EC+DVPQSKFRIK +T+ Sbjct: 6 GTPADSYYQVREECSDVPQSKFRIKAGKTL 35