BLASTX nr result
ID: Rehmannia27_contig00007301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00007301 (398 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095576.1| PREDICTED: serine/threonine-protein phosphat... 58 3e-07 >ref|XP_011095576.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Sesamum indicum] gi|747095404|ref|XP_011095577.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Sesamum indicum] Length = 1042 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/61 (49%), Positives = 41/61 (67%) Frame = -1 Query: 398 REPSPSTVNPSVIDLPCGPQGHHNSVVMLKDVETNISSEDNAQKLTEYDDTAQRVTEEKE 219 RE SPS VNPS++D+PC P G +SV+ L DV+ + S EDN +T+ DT Q VT +E Sbjct: 766 REASPSPVNPSMLDIPCEPPGDQDSVLPLTDVK-SFSQEDNVPMVTDSADTPQPVTVLEE 824 Query: 218 S 216 + Sbjct: 825 N 825