BLASTX nr result
ID: Rehmannia27_contig00007300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00007300 (432 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095576.1| PREDICTED: serine/threonine-protein phosphat... 58 3e-07 >ref|XP_011095576.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Sesamum indicum] gi|747095404|ref|XP_011095577.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Sesamum indicum] Length = 1042 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -2 Query: 410 SAPDPFTGHANGKSLLEPLIEGESQVTIAVPAAVFRDDVQKKYKRQRRSVPKQ 252 S+P+P T H +GKS L+ EG SQVT A RDDVQ+KYKRQRRS PKQ Sbjct: 990 SSPNPETVHNHGKSPLKSWHEGASQVT-ETDTATARDDVQRKYKRQRRSAPKQ 1041