BLASTX nr result
ID: Rehmannia27_contig00006797
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00006797 (369 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854299.1| PREDICTED: probable phospholipid hydroperoxi... 104 3e-26 ref|XP_011080969.1| PREDICTED: probable phospholipid hydroperoxi... 101 5e-25 ref|XP_009346754.1| PREDICTED: probable phospholipid hydroperoxi... 100 3e-24 dbj|BAS90433.1| Os04g0556300, partial [Oryza sativa Japonica Group] 97 5e-24 ref|XP_011072526.1| PREDICTED: probable phospholipid hydroperoxi... 99 8e-24 gb|ABR25794.1| phospholipid hydroperoxide glutathione peroxidase... 95 1e-23 gb|AAA76742.1| putative ORF1, partial [Avena fatua] 96 2e-23 gb|EEC77777.1| hypothetical protein OsI_16938 [Oryza sativa Indi... 97 2e-23 ref|XP_006652625.1| PREDICTED: probable phospholipid hydroperoxi... 97 2e-23 ref|XP_015635940.1| PREDICTED: probable phospholipid hydroperoxi... 97 2e-23 ref|NP_001105091.1| GP protein [Zea mays] gi|22268405|gb|AAM8884... 97 2e-23 emb|CAD41644.2| OSJNBb0012E24.9 [Oryza sativa Japonica Group] 97 2e-23 gb|AAP80645.1|AF475124_1 glutathione peroxidase-like protein, pa... 96 2e-23 ref|XP_011072518.1| PREDICTED: probable phospholipid hydroperoxi... 99 4e-23 emb|CBI34679.3| unnamed protein product [Vitis vinifera] 97 4e-23 gb|EMT04066.1| Putative phospholipid hydroperoxide glutathione p... 97 5e-23 ref|XP_002446921.1| hypothetical protein SORBIDRAFT_06g024920 [S... 96 6e-23 ref|NP_001141210.1| putative glutathione peroxidase [Zea mays] g... 96 6e-23 gb|KQL30844.1| hypothetical protein SETIT_018223mg [Setaria ital... 96 6e-23 emb|CAJ43709.1| glutathion peroxidase [Plantago major] 96 6e-23 >ref|XP_012854299.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Erythranthe guttata] gi|604304136|gb|EYU23486.1| hypothetical protein MIMGU_mgv1a015049mg [Erythranthe guttata] Length = 169 Score = 104 bits (260), Expect = 3e-26 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 YMKS+KGSLFGDNIKWNFSKFLVDKEGQ+VDRYAPTT+PLSIEKDIKKLL KA Sbjct: 117 YMKSIKGSLFGDNIKWNFSKFLVDKEGQVVDRYAPTTTPLSIEKDIKKLLEKA 169 >ref|XP_011080969.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Sesamum indicum] Length = 169 Score = 101 bits (252), Expect = 5e-25 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 YMKSVKG LFGDNIKWNFSKFLV+KEG++VDRYAPTTSPLSIEKDIKKLL KA Sbjct: 117 YMKSVKGGLFGDNIKWNFSKFLVNKEGEVVDRYAPTTSPLSIEKDIKKLLEKA 169 >ref|XP_009346754.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Pyrus x bretschneideri] Length = 168 Score = 99.8 bits (247), Expect = 3e-24 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGDNIKWNFSKFLVDKEG++VDRYAPTTSPLSIEKD+KKLLG A Sbjct: 116 YLKSSKGGLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLGVA 168 >dbj|BAS90433.1| Os04g0556300, partial [Oryza sativa Japonica Group] Length = 114 Score = 97.4 bits (241), Expect = 5e-24 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 62 YLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 114 >ref|XP_011072526.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase isoform X2 [Sesamum indicum] Length = 169 Score = 98.6 bits (244), Expect = 8e-24 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLL KA Sbjct: 117 YLKSAKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLEKA 169 >gb|ABR25794.1| phospholipid hydroperoxide glutathione peroxidase, partial [Oryza sativa Indica Group] Length = 52 Score = 94.7 bits (234), Expect = 1e-23 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -2 Query: 365 MKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 +KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 1 LKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 52 >gb|AAA76742.1| putative ORF1, partial [Avena fatua] Length = 116 Score = 95.9 bits (237), Expect = 2e-23 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLG 216 ++KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG Sbjct: 64 FLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLG 114 >gb|EEC77777.1| hypothetical protein OsI_16938 [Oryza sativa Indica Group] Length = 168 Score = 97.4 bits (241), Expect = 2e-23 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 116 YLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 168 >ref|XP_006652625.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Oryza brachyantha] Length = 168 Score = 97.4 bits (241), Expect = 2e-23 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 116 YLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 168 >ref|XP_015635940.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Oryza sativa Japonica Group] gi|21360380|gb|AAM47493.1| glutathione peroxidase 1 [Oryza sativa] gi|113565095|dbj|BAF15438.1| Os04g0556300 [Oryza sativa Japonica Group] gi|215693018|dbj|BAG88438.1| unnamed protein product [Oryza sativa Japonica Group] gi|222629338|gb|EEE61470.1| hypothetical protein OsJ_15735 [Oryza sativa Japonica Group] gi|937915513|dbj|BAS90432.1| Os04g0556300 [Oryza sativa Japonica Group] Length = 168 Score = 97.4 bits (241), Expect = 2e-23 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 116 YLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 168 >ref|NP_001105091.1| GP protein [Zea mays] gi|22268405|gb|AAM88847.2|AF520911_1 putative glutathione peroxidase [Zea mays] Length = 168 Score = 97.4 bits (241), Expect = 2e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLG 216 ++KS KGSLFGDNIKWNFSKFLVDKEG +V+RYAPTTSPLSIEKDIKKLLG Sbjct: 116 FLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEKDIKKLLG 166 >emb|CAD41644.2| OSJNBb0012E24.9 [Oryza sativa Japonica Group] Length = 171 Score = 97.4 bits (241), Expect = 2e-23 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 119 YLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 171 >gb|AAP80645.1|AF475124_1 glutathione peroxidase-like protein, partial [Triticum aestivum] Length = 119 Score = 95.9 bits (237), Expect = 2e-23 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 ++KS KG LFGD+IKWNFSKFLVDKEG +VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 67 FLKSSKGGLFGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLLGSS 119 >ref|XP_011072518.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase isoform X1 [Sesamum indicum] Length = 239 Score = 98.6 bits (244), Expect = 4e-23 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 Y+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLL KA Sbjct: 187 YLKSAKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLEKA 239 >emb|CBI34679.3| unnamed protein product [Vitis vinifera] Length = 168 Score = 96.7 bits (239), Expect = 4e-23 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLG 216 ++KS KG LFGDNIKWNFSKFLVDK+G++VDRYAPTTSPLSIEKDIKKLLG Sbjct: 116 FLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTTSPLSIEKDIKKLLG 166 >gb|EMT04066.1| Putative phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Aegilops tauschii] Length = 169 Score = 96.7 bits (239), Expect = 5e-23 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLL 219 ++KS KGSLFGDNIKWNFSKFLVDKEG +VDRYAPTTSPLSIEKDIKKLL Sbjct: 117 FLKSSKGSLFGDNIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDIKKLL 166 >ref|XP_002446921.1| hypothetical protein SORBIDRAFT_06g024920 [Sorghum bicolor] gi|48374968|gb|AAT42166.1| putative glutathione peroxidase [Sorghum bicolor] gi|241938104|gb|EES11249.1| hypothetical protein SORBI_006G173900 [Sorghum bicolor] gi|530278482|gb|AGT16461.1| phospholipid-hydroperoxide glutathione peroxidase [Saccharum hybrid cultivar R570] Length = 168 Score = 96.3 bits (238), Expect = 6e-23 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 ++KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 116 FLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 168 >ref|NP_001141210.1| putative glutathione peroxidase [Zea mays] gi|48374955|gb|AAT42154.1| putative glutathione peroxidase [Zea mays] gi|194703274|gb|ACF85721.1| unknown [Zea mays] gi|195622840|gb|ACG33250.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] gi|223975959|gb|ACN32167.1| unknown [Zea mays] gi|414585925|tpg|DAA36496.1| TPA: glutathione peroxidase isoform 1 [Zea mays] gi|414585926|tpg|DAA36497.1| TPA: glutathione peroxidase isoform 2 [Zea mays] Length = 168 Score = 96.3 bits (238), Expect = 6e-23 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 ++KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDIKKLLG + Sbjct: 116 FLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS 168 >gb|KQL30844.1| hypothetical protein SETIT_018223mg [Setaria italica] Length = 168 Score = 96.3 bits (238), Expect = 6e-23 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLG 216 ++KS KGSLFG+NIKWNFSKFLVDKEG++V+RYAPTTSPLSIEKDIKKLLG Sbjct: 116 FLKSSKGSLFGENIKWNFSKFLVDKEGRVVERYAPTTSPLSIEKDIKKLLG 166 >emb|CAJ43709.1| glutathion peroxidase [Plantago major] Length = 168 Score = 96.3 bits (238), Expect = 6e-23 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 368 YMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDIKKLLGKA 210 ++KS KG LFGD IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKD+KKLL KA Sbjct: 116 FLKSAKGGLFGDGIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLEKA 168