BLASTX nr result
ID: Rehmannia27_contig00005177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00005177 (439 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100406.1| PREDICTED: epidermal growth factor receptor ... 66 5e-10 gb|EYU43537.1| hypothetical protein MIMGU_mgv1a000764mg [Erythra... 63 8e-09 ref|XP_012829934.1| PREDICTED: actin cytoskeleton-regulatory com... 63 8e-09 >ref|XP_011100406.1| PREDICTED: epidermal growth factor receptor substrate 15-like [Sesamum indicum] gi|747046591|ref|XP_011100414.1| PREDICTED: epidermal growth factor receptor substrate 15-like [Sesamum indicum] Length = 1092 Score = 66.2 bits (160), Expect = 5e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 MAGAGGVNMEKFEEYFQRADLDRDGRISGAE 3 MAGAGGVNMEKFEEYFQRADLDRDGRISGAE Sbjct: 1 MAGAGGVNMEKFEEYFQRADLDRDGRISGAE 31 >gb|EYU43537.1| hypothetical protein MIMGU_mgv1a000764mg [Erythranthe guttata] Length = 991 Score = 62.8 bits (151), Expect = 8e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 95 MAGAGGVNMEKFEEYFQRADLDRDGRISGAE 3 MAGAGGVN+EKFEEYFQRAD+DRDG+ISGAE Sbjct: 1 MAGAGGVNLEKFEEYFQRADVDRDGKISGAE 31 >ref|XP_012829934.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1 [Erythranthe guttata] Length = 1063 Score = 62.8 bits (151), Expect = 8e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 95 MAGAGGVNMEKFEEYFQRADLDRDGRISGAE 3 MAGAGGVN+EKFEEYFQRAD+DRDG+ISGAE Sbjct: 1 MAGAGGVNLEKFEEYFQRADVDRDGKISGAE 31