BLASTX nr result
ID: Rehmannia27_contig00002365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00002365 (1214 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072553.1| PREDICTED: mitochondrial import inner membra... 115 7e-27 ref|XP_012856473.1| PREDICTED: mitochondrial import inner membra... 112 1e-25 ref|XP_011079930.1| PREDICTED: mitochondrial import inner membra... 110 3e-25 ref|XP_012836514.1| PREDICTED: mitochondrial import inner membra... 109 7e-25 ref|XP_009795181.1| PREDICTED: mitochondrial import inner membra... 97 2e-20 ref|XP_009616035.1| PREDICTED: mitochondrial import inner membra... 97 2e-20 ref|XP_006342960.1| PREDICTED: mitochondrial import inner membra... 96 9e-20 ref|XP_015067553.1| PREDICTED: mitochondrial import inner membra... 95 2e-19 ref|XP_004235579.1| PREDICTED: mitochondrial import inner membra... 94 4e-19 gb|KVH92977.1| Mitochondrial inner membrane translocase subunit ... 94 6e-19 ref|XP_009389345.1| PREDICTED: mitochondrial import inner membra... 92 3e-18 ref|XP_002278010.2| PREDICTED: mitochondrial import inner membra... 91 1e-17 ref|XP_009389303.1| PREDICTED: mitochondrial import inner membra... 90 2e-17 ref|XP_010933796.1| PREDICTED: mitochondrial import inner membra... 89 4e-17 ref|XP_004986001.1| PREDICTED: mitochondrial import inner membra... 89 4e-17 ref|XP_015632212.1| PREDICTED: mitochondrial import inner membra... 89 4e-17 emb|CDO97884.1| unnamed protein product [Coffea canephora] 89 4e-17 gb|ACG25106.1| mitochondrial import inner membrane translocase s... 89 5e-17 ref|NP_001150041.2| mitochondrial import inner membrane transloc... 89 5e-17 ref|XP_006650974.1| PREDICTED: mitochondrial import inner membra... 87 5e-17 >ref|XP_011072553.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Sesamum indicum] Length = 191 Score = 115 bits (287), Expect = 7e-27 Identities = 50/62 (80%), Positives = 59/62 (95%) Frame = -2 Query: 187 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLT 8 P+APNQ N+ D+S+SNRRLYNPYQDLHLPT+T+YNLP+SPEFLFQEE+ A+RRSWGENLT Sbjct: 5 PRAPNQGNSADESNSNRRLYNPYQDLHLPTQTLYNLPTSPEFLFQEEAHAQRRSWGENLT 64 Query: 7 YY 2 YY Sbjct: 65 YY 66 >ref|XP_012856473.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1 [Erythranthe guttata] gi|604301763|gb|EYU21349.1| hypothetical protein MIMGU_mgv1a014438mg [Erythranthe guttata] Length = 189 Score = 112 bits (279), Expect = 1e-25 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = -2 Query: 187 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLT 8 P+ PNQSN D+SSSNRRLYNPYQDLHLP KT+YNLP+SPEFLFQEE++A+RRSWGENLT Sbjct: 5 PKDPNQSN--DESSSNRRLYNPYQDLHLPAKTLYNLPTSPEFLFQEEAVAQRRSWGENLT 62 Query: 7 YY 2 YY Sbjct: 63 YY 64 >ref|XP_011079930.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Sesamum indicum] Length = 191 Score = 110 bits (276), Expect = 3e-25 Identities = 48/62 (77%), Positives = 59/62 (95%) Frame = -2 Query: 187 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLT 8 P+AP+ S+ TD++S NRRLYNPYQDL+LPT+T+YNLP+SPEFLFQEES+A+RRSWGENLT Sbjct: 5 PRAPDHSSATDENSRNRRLYNPYQDLNLPTQTLYNLPTSPEFLFQEESLAQRRSWGENLT 64 Query: 7 YY 2 YY Sbjct: 65 YY 66 >ref|XP_012836514.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Erythranthe guttata] gi|604347717|gb|EYU45872.1| hypothetical protein MIMGU_mgv1a027042mg [Erythranthe guttata] Length = 191 Score = 109 bits (273), Expect = 7e-25 Identities = 48/62 (77%), Positives = 57/62 (91%) Frame = -2 Query: 187 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLT 8 P+APN S+ +D++ SNRRLYNPYQDL LP KT+YNLP+SPEFLFQEE+IA+RRSWGENLT Sbjct: 5 PRAPNHSSGSDENESNRRLYNPYQDLRLPAKTLYNLPTSPEFLFQEEAIAQRRSWGENLT 64 Query: 7 YY 2 YY Sbjct: 65 YY 66 >ref|XP_009795181.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Nicotiana sylvestris] Length = 190 Score = 97.4 bits (241), Expect = 2e-20 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -2 Query: 184 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTY 5 Q+PN + D NRRLYNPYQDLH+P +T+Y LP+SPEFLFQEES+A+RRSWGENLTY Sbjct: 6 QSPNHNGEND-DGQNRRLYNPYQDLHVPIQTLYKLPTSPEFLFQEESVAQRRSWGENLTY 64 Query: 4 Y 2 Y Sbjct: 65 Y 65 >ref|XP_009616035.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2 [Nicotiana tomentosiformis] Length = 190 Score = 97.4 bits (241), Expect = 2e-20 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -2 Query: 184 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTY 5 Q+PN + D NRRLYNPYQDLH+P +T+Y LP+SPEFLFQEES+A+RRSWGENLTY Sbjct: 6 QSPNHNGEND-DGKNRRLYNPYQDLHVPIQTLYKLPTSPEFLFQEESVAQRRSWGENLTY 64 Query: 4 Y 2 Y Sbjct: 65 Y 65 >ref|XP_006342960.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Solanum tuberosum] Length = 191 Score = 95.9 bits (237), Expect = 9e-20 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -2 Query: 184 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTY 5 Q+PN + D NRRLYNPYQDL +P KT+Y LP+SPEFLFQEES+A+RRSWGENLTY Sbjct: 7 QSPNHTGDND-DGKNRRLYNPYQDLQVPIKTLYKLPTSPEFLFQEESVAQRRSWGENLTY 65 Query: 4 Y 2 Y Sbjct: 66 Y 66 >ref|XP_015067553.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1 [Solanum pennellii] Length = 190 Score = 94.7 bits (234), Expect = 2e-19 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -2 Query: 184 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTY 5 Q+PN + + NRRLYNPYQDL +P KT+Y LP+SPEFLFQEESIA+RRSWGENLTY Sbjct: 6 QSPNHTGDNE-DGKNRRLYNPYQDLQVPMKTLYKLPTSPEFLFQEESIAQRRSWGENLTY 64 Query: 4 Y 2 Y Sbjct: 65 Y 65 >ref|XP_004235579.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Solanum lycopersicum] Length = 190 Score = 94.0 bits (232), Expect = 4e-19 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -2 Query: 184 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTY 5 Q+ N + D NRRLYNPYQDL +P+KT+Y LP+SPEFLFQEESIA+RRSWGENLTY Sbjct: 6 QSSNHTGDND-DGKNRRLYNPYQDLQVPSKTLYKLPTSPEFLFQEESIAQRRSWGENLTY 64 Query: 4 Y 2 Y Sbjct: 65 Y 65 >gb|KVH92977.1| Mitochondrial inner membrane translocase subunit Tim17/Tim22/Tim23/peroxisomal protein PMP24 [Cynara cardunculus var. scolymus] Length = 190 Score = 93.6 bits (231), Expect = 6e-19 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = -2 Query: 187 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLT 8 P++ N N TD NRRLYNPYQDL +P +T+Y LP+SPE+LFQEES+A+RRSWGENLT Sbjct: 5 PRSSNH-NETDDDRHNRRLYNPYQDLGVPVQTLYKLPTSPEYLFQEESVAQRRSWGENLT 63 Query: 7 YY 2 YY Sbjct: 64 YY 65 >ref|XP_009389345.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Musa acuminata subsp. malaccensis] Length = 191 Score = 91.7 bits (226), Expect = 3e-18 Identities = 39/51 (76%), Positives = 47/51 (92%) Frame = -2 Query: 154 KSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 + S NRRLYNPYQDL +P +T+Y+LP+SPEFLFQEES+A+RRSWGENLTYY Sbjct: 16 QDSGNRRLYNPYQDLQIPYRTLYDLPTSPEFLFQEESLAQRRSWGENLTYY 66 >ref|XP_002278010.2| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1 [Vitis vinifera] Length = 237 Score = 91.3 bits (225), Expect = 1e-17 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -2 Query: 163 TTDKSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 T+ + NRRLYNPYQDL +P + IY LP+SPEFLFQEES+A+RRSWGENLTYY Sbjct: 59 TSQNDNDNRRLYNPYQDLQIPIQNIYKLPTSPEFLFQEESVAQRRSWGENLTYY 112 >ref|XP_009389303.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Musa acuminata subsp. malaccensis] Length = 191 Score = 89.7 bits (221), Expect = 2e-17 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -2 Query: 154 KSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 + SS RRLYNPY DL +P +T+Y+LP+SPEFLFQEESIA+RRSWGENLTYY Sbjct: 16 QDSSGRRLYNPYHDLQIPHRTLYDLPTSPEFLFQEESIAERRSWGENLTYY 66 >ref|XP_010933796.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Elaeis guineensis] Length = 190 Score = 88.6 bits (218), Expect = 4e-17 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -2 Query: 154 KSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 + +RRLYNPYQDL +P +T+Y+LP+SPEFLFQEES+A+RRSWGENLTYY Sbjct: 15 RQEPSRRLYNPYQDLQIPYRTLYDLPTSPEFLFQEESVAQRRSWGENLTYY 65 >ref|XP_004986001.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Setaria italica] gi|944228571|gb|KQK92975.1| hypothetical protein SETIT_037646mg [Setaria italica] Length = 191 Score = 88.6 bits (218), Expect = 4e-17 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -2 Query: 154 KSSSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 + S RRLYNPYQDL++P K +Y+LP+SPEFLFQEE+IA+RRSWGENLTYY Sbjct: 15 RDDSGRRLYNPYQDLNIPYKQLYDLPTSPEFLFQEEAIAQRRSWGENLTYY 65 >ref|XP_015632212.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2 [Oryza sativa Japonica Group] gi|27476098|gb|AAO17029.1| Putative mitochondrial inner membrane protein [Oryza sativa Japonica Group] gi|108705843|gb|ABF93638.1| Mitochondrial import inner membrane translocase subunit Tim17 family protein, expressed [Oryza sativa Japonica Group] gi|113547218|dbj|BAF10661.1| Os03g0114900 [Oryza sativa Japonica Group] gi|215737360|dbj|BAG96289.1| unnamed protein product [Oryza sativa Japonica Group] gi|937907043|dbj|BAS81963.1| Os03g0114900 [Oryza sativa Japonica Group] Length = 194 Score = 88.6 bits (218), Expect = 4e-17 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -2 Query: 148 SSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 +S RRLYNPYQDL++P K +Y+LP+SPEFLFQEES+A+RRSWGENLTYY Sbjct: 20 ASGRRLYNPYQDLNIPYKQLYDLPTSPEFLFQEESLAQRRSWGENLTYY 68 >emb|CDO97884.1| unnamed protein product [Coffea canephora] Length = 195 Score = 88.6 bits (218), Expect = 4e-17 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 4/66 (6%) Frame = -2 Query: 187 PQAPNQSNTTDKS----SSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWG 20 P+APN + D++ S RLYNPYQDL +P +T+Y LP+SPEFLFQEE+IA RRSWG Sbjct: 5 PRAPNFDDDDDQNNTAPSDGARLYNPYQDLKVPIQTLYRLPTSPEFLFQEEAIALRRSWG 64 Query: 19 ENLTYY 2 EN+TYY Sbjct: 65 ENMTYY 70 >gb|ACG25106.1| mitochondrial import inner membrane translocase subunit tim23 [Zea mays] Length = 197 Score = 88.6 bits (218), Expect = 5e-17 Identities = 40/64 (62%), Positives = 51/64 (79%), Gaps = 5/64 (7%) Frame = -2 Query: 178 PNQSNTTDKSS-----SNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGEN 14 P +S + D+ S RRLYNPYQDL+LP + +Y+LP+SPEFLFQEE++A+RRSWGEN Sbjct: 8 PTESGSDDRRDAAYPGSERRLYNPYQDLNLPYRQLYDLPTSPEFLFQEEAVAQRRSWGEN 67 Query: 13 LTYY 2 LTYY Sbjct: 68 LTYY 71 >ref|NP_001150041.2| mitochondrial import inner membrane translocase subunit tim23 [Zea mays] gi|238013924|gb|ACR37997.1| unknown [Zea mays] gi|413957162|gb|AFW89811.1| putative mitochondrial import inner membrane translocase subunit TIM23 family protein [Zea mays] Length = 197 Score = 88.6 bits (218), Expect = 5e-17 Identities = 40/64 (62%), Positives = 51/64 (79%), Gaps = 5/64 (7%) Frame = -2 Query: 178 PNQSNTTDKSS-----SNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGEN 14 P +S + D+ S RRLYNPYQDL+LP + +Y+LP+SPEFLFQEE++A+RRSWGEN Sbjct: 8 PTESGSDDRRDAAYPGSERRLYNPYQDLNLPYRQLYDLPTSPEFLFQEEAVAQRRSWGEN 67 Query: 13 LTYY 2 LTYY Sbjct: 68 LTYY 71 >ref|XP_006650974.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Oryza brachyantha] Length = 133 Score = 86.7 bits (213), Expect = 5e-17 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -2 Query: 148 SSNRRLYNPYQDLHLPTKTIYNLPSSPEFLFQEESIAKRRSWGENLTYY 2 +S RR YNPYQDL++P K +Y+LP+SPEFLFQEES+A+RRSWGENLTYY Sbjct: 20 ASGRRTYNPYQDLNIPYKQLYDLPTSPEFLFQEESLAQRRSWGENLTYY 68