BLASTX nr result
ID: Rehmannia27_contig00000780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00000780 (456 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AID23868.1| vanillin synthase [Glechoma hederacea] 63 5e-09 ref|XP_012848129.1| PREDICTED: thiol protease aleurain-like [Ery... 62 1e-08 ref|XP_011078092.1| PREDICTED: cysteine proteinase 3-like [Sesam... 61 3e-08 ref|XP_012851301.1| PREDICTED: cysteine proteinase 3-like [Eryth... 56 2e-06 >gb|AID23868.1| vanillin synthase [Glechoma hederacea] Length = 358 Score = 63.2 bits (152), Expect = 5e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 309 MTRALLLVFGVLIACVAGARAGSEFLAEENPIRQVVD 419 M R LLL+ GVLIAC AGARAGSEFLAE+NPIRQVVD Sbjct: 1 MARLLLLLVGVLIACAAGARAGSEFLAEDNPIRQVVD 37 >ref|XP_012848129.1| PREDICTED: thiol protease aleurain-like [Erythranthe guttata] gi|604315763|gb|EYU28328.1| hypothetical protein MIMGU_mgv1a008911mg [Erythranthe guttata] Length = 358 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 309 MTRALLLVFGVLIACVAGARAGSEFLAEENPIRQVVD 419 M R LL GVLIAC+AGARAGSEFLA+ENPIRQVVD Sbjct: 1 MARVALLAVGVLIACIAGARAGSEFLADENPIRQVVD 37 >ref|XP_011078092.1| PREDICTED: cysteine proteinase 3-like [Sesamum indicum] Length = 358 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 309 MTRALLLVFGVLIACVAGARAGSEFLAEENPIRQVVD 419 M R LLLVFGVLIA AG +AGSEFLAEENPIRQVVD Sbjct: 1 MARTLLLVFGVLIAFFAGTQAGSEFLAEENPIRQVVD 37 >ref|XP_012851301.1| PREDICTED: cysteine proteinase 3-like [Erythranthe guttata] gi|604311855|gb|EYU25849.1| hypothetical protein MIMGU_mgv1a008894mg [Erythranthe guttata] Length = 359 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/38 (78%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +3 Query: 309 MTRALLLVFGVLIACVAGARAGSEFLAEE-NPIRQVVD 419 M R LL+ GVLIACVAGARAGSE LAE+ NPIRQVVD Sbjct: 1 MARFFLLLVGVLIACVAGARAGSEILAEDVNPIRQVVD 38