BLASTX nr result
ID: Rehmannia26_contig00035276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00035276 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] 56 4e-06 >emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] Length = 1250 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 367 GMGTKIHCKSQVLPGFYSMRDLNEDSSSSSWPL 465 GMGTK+ CKS LPG+YSMRDLNEDS+S WPL Sbjct: 102 GMGTKVQCKSY-LPGYYSMRDLNEDSNSGGWPL 133