BLASTX nr result
ID: Rehmannia26_contig00035266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00035266 (463 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311997.2| hypothetical protein POPTR_0008s03580g [Popu... 56 4e-06 ref|XP_002311177.2| hypothetical protein POPTR_0008s05800g [Popu... 55 1e-05 >ref|XP_002311997.2| hypothetical protein POPTR_0008s03580g [Populus trichocarpa] gi|550332356|gb|EEE89364.2| hypothetical protein POPTR_0008s03580g [Populus trichocarpa] Length = 54 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = +3 Query: 165 KEKTSFRKRHVGGXXXXXXXXXXXXMKEQRARFYILRRCVVMLICWQDYND 317 +E T F +HV +KEQRARFYILRRCV ML+CW DY + Sbjct: 3 QENTGFCSKHVRDPCRSFGRRCSSLVKEQRARFYILRRCVTMLVCWHDYGE 53 >ref|XP_002311177.2| hypothetical protein POPTR_0008s05800g [Populus trichocarpa] gi|550332505|gb|EEE88544.2| hypothetical protein POPTR_0008s05800g [Populus trichocarpa] Length = 84 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 240 MKEQRARFYILRRCVVMLICWQDYND 317 +KEQRARFYI+RRCV MLICW+DYND Sbjct: 58 VKEQRARFYIMRRCVTMLICWRDYND 83