BLASTX nr result
ID: Rehmannia26_contig00035045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00035045 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34966.3| unnamed protein product [Vitis vinifera] 65 9e-09 ref|XP_002275234.1| PREDICTED: ankyrin repeat domain-containing ... 65 9e-09 ref|XP_004246551.1| PREDICTED: ankyrin repeat domain-containing ... 64 2e-08 ref|XP_006341150.1| PREDICTED: ankyrin repeat domain-containing ... 64 3e-08 ref|XP_002517389.1| aberrant large forked product, putative [Ric... 64 3e-08 ref|XP_004309909.1| PREDICTED: ankyrin repeat domain-containing ... 61 1e-07 ref|XP_002451459.1| hypothetical protein SORBIDRAFT_04g002300 [S... 60 2e-07 ref|NP_001130088.1| uncharacterized protein LOC100191181 [Zea ma... 60 2e-07 gb|EOY02305.1| Ankyrin repeat family protein [Theobroma cacao] 60 4e-07 ref|XP_006591310.1| PREDICTED: ankyrin repeat domain-containing ... 59 5e-07 ref|XP_003552889.1| PREDICTED: ankyrin repeat domain-containing ... 59 5e-07 gb|ESW18977.1| hypothetical protein PHAVU_006G086600g [Phaseolus... 59 7e-07 ref|XP_003564031.1| PREDICTED: ankyrin repeat domain-containing ... 59 7e-07 ref|XP_004965091.1| PREDICTED: ankyrin repeat domain-containing ... 58 1e-06 ref|XP_004965090.1| PREDICTED: ankyrin repeat domain-containing ... 58 1e-06 ref|XP_004965089.1| PREDICTED: ankyrin repeat domain-containing ... 58 1e-06 gb|ACF80469.2| unknown [Zea mays] gi|413926728|gb|AFW66660.1| hy... 58 1e-06 gb|EXC45077.1| Ankyrin repeat domain-containing protein [Morus n... 58 1e-06 gb|EAZ36411.1| hypothetical protein OsJ_20741 [Oryza sativa Japo... 58 1e-06 gb|EAZ00296.1| hypothetical protein OsI_22312 [Oryza sativa Indi... 58 1e-06 >emb|CBI34966.3| unnamed protein product [Vitis vinifera] Length = 232 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RRN+DG TPLDLSLCYGKDFKSYELAKL+K V A+R Sbjct: 195 RRNQDGKTPLDLSLCYGKDFKSYELAKLLKLVPANR 230 >ref|XP_002275234.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic [Vitis vinifera] gi|147786877|emb|CAN75542.1| hypothetical protein VITISV_022633 [Vitis vinifera] Length = 322 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RRN+DG TPLDLSLCYGKDFKSYELAKL+K V A+R Sbjct: 285 RRNQDGKTPLDLSLCYGKDFKSYELAKLLKLVPANR 320 >ref|XP_004246551.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Solanum lycopersicum] Length = 317 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 R+NKDG TPLD+SLCYGKDFKSY+LAKL+K V+A+R Sbjct: 280 RKNKDGKTPLDISLCYGKDFKSYDLAKLLKLVNANR 315 >ref|XP_006341150.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Solanum tuberosum] Length = 324 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 R+NKDG TPLD+SLCYGKDFKSY+LAKL+K V A+R Sbjct: 287 RKNKDGKTPLDISLCYGKDFKSYDLAKLLKLVPANR 322 >ref|XP_002517389.1| aberrant large forked product, putative [Ricinus communis] gi|223543400|gb|EEF44931.1| aberrant large forked product, putative [Ricinus communis] Length = 343 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASRGF 274 R+NKDG TP+DL LCYGKDFKSY+LAKLVK V A+R F Sbjct: 306 RKNKDGMTPVDLCLCYGKDFKSYDLAKLVKVVPANRDF 343 >ref|XP_004309909.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 338 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASRGF 274 RRNKDG TP+DL LCYGKDFKSY+L KL+K V R F Sbjct: 301 RRNKDGRTPIDLGLCYGKDFKSYDLTKLLKTVPMDREF 338 >ref|XP_002451459.1| hypothetical protein SORBIDRAFT_04g002300 [Sorghum bicolor] gi|241931290|gb|EES04435.1| hypothetical protein SORBIDRAFT_04g002300 [Sorghum bicolor] Length = 299 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASRG 277 RR KDG T LDLSLC+G+DFKSY+LAKLVK + A+RG Sbjct: 262 RRTKDGRTALDLSLCFGRDFKSYDLAKLVKLIPANRG 298 >ref|NP_001130088.1| uncharacterized protein LOC100191181 [Zea mays] gi|194688260|gb|ACF78214.1| unknown [Zea mays] gi|195624436|gb|ACG34048.1| ankyrin repeat protein [Zea mays] gi|413926729|gb|AFW66661.1| ankyrin repeat protein [Zea mays] Length = 299 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASRG 277 RR KDG T LDLSLC+G+DFKSY+LAKLVK + A+RG Sbjct: 262 RRTKDGRTALDLSLCFGRDFKSYDLAKLVKLIPANRG 298 >gb|EOY02305.1| Ankyrin repeat family protein [Theobroma cacao] Length = 330 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASRGF 274 R+NKDG T LDLSLCYGKDFKSY+LAKL+K + R F Sbjct: 293 RKNKDGQTALDLSLCYGKDFKSYDLAKLLKILPVDRDF 330 >ref|XP_006591310.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Glycine max] Length = 330 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSA 286 R+NKDG T LDLSLCYGKDFKSY+LAKL+K V A Sbjct: 293 RKNKDGKTALDLSLCYGKDFKSYDLAKLLKTVPA 326 >ref|XP_003552889.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Glycine max] Length = 331 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSA 286 R+NKDG T LDLSLCYGKDFKSY+LAKL+K V A Sbjct: 293 RKNKDGKTALDLSLCYGKDFKSYDLAKLLKTVPA 326 >gb|ESW18977.1| hypothetical protein PHAVU_006G086600g [Phaseolus vulgaris] Length = 320 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSA 286 R+NKDG T LDLS CYGKDFKSYELAKL+K V A Sbjct: 283 RKNKDGKTALDLSFCYGKDFKSYELAKLLKTVPA 316 >ref|XP_003564031.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Brachypodium distachyon] Length = 306 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR K G TPLDLSLC+G+DF SY+LAKLVK VSA+R Sbjct: 269 RRTKGGRTPLDLSLCFGRDFNSYDLAKLVKLVSANR 304 >ref|XP_004965091.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like isoform X3 [Setaria italica] Length = 306 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR KDG T LDLSLC+G+DFKSY+LAKLVK + A+R Sbjct: 270 RRTKDGRTALDLSLCFGRDFKSYDLAKLVKLIPANR 305 >ref|XP_004965090.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like isoform X2 [Setaria italica] Length = 338 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR KDG T LDLSLC+G+DFKSY+LAKLVK + A+R Sbjct: 302 RRTKDGRTALDLSLCFGRDFKSYDLAKLVKLIPANR 337 >ref|XP_004965089.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like isoform X1 [Setaria italica] Length = 428 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR KDG T LDLSLC+G+DFKSY+LAKLVK + A+R Sbjct: 392 RRTKDGRTALDLSLCFGRDFKSYDLAKLVKLIPANR 427 >gb|ACF80469.2| unknown [Zea mays] gi|413926728|gb|AFW66660.1| hypothetical protein ZEAMMB73_120984 [Zea mays] Length = 312 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR KDG T LDLSLC+G+DFKSY+LAKLVK + A+R Sbjct: 262 RRTKDGRTALDLSLCFGRDFKSYDLAKLVKLIPANR 297 >gb|EXC45077.1| Ankyrin repeat domain-containing protein [Morus notabilis] Length = 332 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RRNKDG TPLDL+ CYGKDF SY+LA+L+K V +R Sbjct: 295 RRNKDGKTPLDLAFCYGKDFNSYDLARLLKVVPENR 330 >gb|EAZ36411.1| hypothetical protein OsJ_20741 [Oryza sativa Japonica Group] Length = 300 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR KDG T LD+SLC+G+DFKSY+LAKLVK V A+R Sbjct: 263 RRTKDGRTALDISLCFGRDFKSYDLAKLVKLVPANR 298 >gb|EAZ00296.1| hypothetical protein OsI_22312 [Oryza sativa Indica Group] Length = 300 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 387 RRNKDGNTPLDLSLCYGKDFKSYELAKLVKQVSASR 280 RR KDG T LD+SLC+G+DFKSY+LAKLVK V A+R Sbjct: 263 RRTKDGRTALDISLCFGRDFKSYDLAKLVKLVPANR 298