BLASTX nr result
ID: Rehmannia26_contig00034796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00034796 (574 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG72096.1| Gag-protease-integrase-RT-RNaseH polyprotein [Gl... 45 3e-07 emb|CAN74164.1| hypothetical protein VITISV_026444 [Vitis vinifera] 57 3e-06 >dbj|BAG72096.1| Gag-protease-integrase-RT-RNaseH polyprotein [Glycine max] Length = 1321 Score = 45.1 bits (105), Expect(2) = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 3 KKLRPRTISVYFIRYAERSKGC*FYCLSH 89 KKL PRTIS YFI YAERSKG FYC H Sbjct: 639 KKLDPRTISGYFIGYAERSKGYRFYCPHH 667 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 92 TRFVEFRNAKFLEYDLISGSGQ 157 TR VE RNAKF+E DLISGS Q Sbjct: 669 TRIVESRNAKFIENDLISGSDQ 690 >emb|CAN74164.1| hypothetical protein VITISV_026444 [Vitis vinifera] Length = 689 Score = 57.4 bits (137), Expect = 3e-06 Identities = 31/60 (51%), Positives = 36/60 (60%) Frame = +3 Query: 3 KKLRPRTISVYFIRYAERSKGC*FYCLSHRLDLSNLEMQNFLNMT*SVGVVNFLDIIFDI 182 KKL PRTIS YFIRYAE+SKG FYC SH + + FL G F +I+FDI Sbjct: 577 KKLDPRTISGYFIRYAEKSKGYRFYCPSHSIRIVESRNAKFLEYDLVSGSDQFRNIVFDI 636