BLASTX nr result
ID: Rehmannia26_contig00032893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032893 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296004.1| PREDICTED: putative ribonuclease H protein A... 62 8e-08 >ref|XP_004296004.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria vesca subsp. vesca] Length = 751 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 2/98 (2%) Frame = -2 Query: 319 HLFHHCISDYFCDGTWHFTFSFVEAYLDLVRAIVRVPIAPNS--RDTRVWLNSEDGLVTS 146 HL + ++D+ D W F + D + I+ +P+ PN+ D +W +S G+ + Sbjct: 396 HLLNSRVADFIWDQQWALPSHFSNLFPDCAKQILEIPL-PNTPESDILIWEHSSSGIFSF 454 Query: 145 KAAYAHVRPHLLEVKWGSWIWSQHIPEWRSVVAWRAIH 32 Y VRP+ ++ W S +W IP SV+AWR H Sbjct: 455 SDGYELVRPYFEKLDWASSVWHSFIPPRYSVLAWRIFH 492