BLASTX nr result
ID: Rehmannia26_contig00032826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032826 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521311.1| conserved hypothetical protein [Ricinus comm... 55 3e-08 ref|XP_006364158.1| PREDICTED: uncharacterized protein LOC102580... 52 3e-06 >ref|XP_002521311.1| conserved hypothetical protein [Ricinus communis] gi|223539496|gb|EEF41085.1| conserved hypothetical protein [Ricinus communis] Length = 286 Score = 54.7 bits (130), Expect(2) = 3e-08 Identities = 24/63 (38%), Positives = 39/63 (61%) Frame = -3 Query: 426 KYFVEFKKYCRWDEAIDGLVYDAFMDKASTCYNNLIHKFKKKRHLVRPDCVPEDGWGRWL 247 +Y+++F+K+ W+++I +V A+ A+ Y ++ HK+K K RP CVPED W RW Sbjct: 112 RYWIKFQKFLEWEDSIHEMVKLAWEQLAARRYTDMPHKWKGKG---RPPCVPEDVWHRWQ 168 Query: 246 EYW 238 W Sbjct: 169 AKW 171 Score = 28.9 bits (63), Expect(2) = 3e-08 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -2 Query: 196 QNRMSELGGLGTGCSRHTGGPRSIIEHS 113 +N SE GLG+G +R+T G SI EH+ Sbjct: 185 RNHWSETRGLGSGPTRYTCGSISIQEHA 212 >ref|XP_006364158.1| PREDICTED: uncharacterized protein LOC102580264 [Solanum tuberosum] Length = 798 Score = 52.0 bits (123), Expect(2) = 3e-06 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = -3 Query: 423 YFVEFKKYCRWDEAI-DGLVYDAFMDKASTCYNNLIHKFKKKRHLVRPDCVPEDGWGRWL 247 YF EFKK+ WD +I + V +M KA+ Y N I K K + RP VPE W RW+ Sbjct: 324 YFGEFKKFFYWDVSISENEVKKHWMVKATLKYRNFISKIKNEGF--RPGYVPESVWERWM 381 Query: 246 EYWG 235 + WG Sbjct: 382 QLWG 385 Score = 24.3 bits (51), Expect(2) = 3e-06 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 193 NRMSELGGLGTGCSRHTGGPRSIIEH 116 N + GG T HTGG SI EH Sbjct: 396 NSKNHRGGHETAVGTHTGGSISIGEH 421