BLASTX nr result
ID: Rehmannia26_contig00032793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032793 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528689.1| pentatricopeptide repeat-containing protein,... 61 2e-07 gb|EXC23833.1| hypothetical protein L484_006096 [Morus notabilis] 59 5e-07 ref|XP_004246986.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_006429582.1| hypothetical protein CICLE_v10013314mg, part... 57 3e-06 >ref|XP_002528689.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531861|gb|EEF33678.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 271 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/81 (35%), Positives = 53/81 (65%) Frame = +3 Query: 180 KEKQSIYGHTSNRKLQVQDFLETVVTVPSSEKLEAFEKFQRNGEMQTISEFNHLLMSLVA 359 ++++S+ +LQV+ L+ + +P + E + F ++GE+ +IS+FN LLM+LV Sbjct: 40 QKQESVKFDAKASRLQVEKLLDAIRALPFKGRTEILDVFGKDGEIPSISDFNDLLMALVI 99 Query: 360 ADEFELALKLKSNLSSFGLFP 422 A+E +LAL + S++S+ GL P Sbjct: 100 ANELDLALNMYSDVSTLGLVP 120 >gb|EXC23833.1| hypothetical protein L484_006096 [Morus notabilis] Length = 618 Score = 59.3 bits (142), Expect = 5e-07 Identities = 36/97 (37%), Positives = 59/97 (60%), Gaps = 3/97 (3%) Frame = +3 Query: 135 NSINRRKFHLFATPIKE---KQSIYGHTSNRKLQVQDFLETVVTVPSSEKLEAFEKFQRN 305 N I + K + + PI E K Y T++ +QV++ +E V +PS E+ + + +++N Sbjct: 160 NDIVQPKDNNYRLPINEDCPKYLDYDKTASI-IQVKNLVERVQVLPSKERSKTIKIWKQN 218 Query: 306 GEMQTISEFNHLLMSLVAADEFELALKLKSNLSSFGL 416 GE +T+SEFN LLM+L+ D+ LALKL +S G+ Sbjct: 219 GEFETVSEFNDLLMALLFVDDSNLALKLFDEMSFHGV 255 >ref|XP_004246986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Solanum lycopersicum] Length = 461 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 300 RNGEMQTISEFNHLLMSLVAADEFELALKLKSNLSSFGLFP 422 +NG QTIS+FNH L SLV ADEFELALKL S+ SS+GL P Sbjct: 51 KNGGFQTISDFNHQLTSLVLADEFELALKLTSSSSSYGLTP 91 >ref|XP_006429582.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina] gi|557531639|gb|ESR42822.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina] Length = 438 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/69 (39%), Positives = 44/69 (63%) Frame = +3 Query: 216 RKLQVQDFLETVVTVPSSEKLEAFEKFQRNGEMQTISEFNHLLMSLVAADEFELALKLKS 395 R LQ Q F++ + P E+++ F+ +++G ++S+FN LLM+LV +E E A+K S Sbjct: 9 RSLQAQRFVDRIKASPLKERIDIFDSIKKDGTNWSVSDFNDLLMALVMLNEQETAVKFFS 68 Query: 396 NLSSFGLFP 422 SS+GL P Sbjct: 69 EASSYGLAP 77