BLASTX nr result
ID: Rehmannia26_contig00032601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032601 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 >ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum lycopersicum] Length = 602 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/53 (50%), Positives = 38/53 (71%) Frame = -3 Query: 160 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFT 2 +DFT +S++L DP + PGP LE A++ A I + L++FN FDS+PKPLFT Sbjct: 81 TDFTTLSEILRDPTIPPGPALENALDRAGIEVNECMFLQLFNHFDSSPKPLFT 133 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -3 Query: 160 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFT 2 SDF+ I LL+DPAL G LE+A+N I P LL IF+ FD++PKPLFT Sbjct: 70 SDFSTICALLTDPALSSGAPLEDALNRTGIKPCSGLLQAIFSHFDASPKPLFT 122 >ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum tuberosum] Length = 604 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/53 (45%), Positives = 36/53 (67%) Frame = -3 Query: 160 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFT 2 +DFT + ++L DP + GP LE A++ A + + L++FN FDS+PKPLFT Sbjct: 81 TDFTTLCEILRDPIIPAGPVLENALDRAGVEVNECMFLQLFNHFDSSPKPLFT 133 >ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 582 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/53 (45%), Positives = 39/53 (73%) Frame = -3 Query: 160 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFT 2 +DF+ I+KLL+DP++ PG L A++ I+P+P+L+ +F+ FDS+PK L T Sbjct: 55 NDFSTITKLLTDPSIFPGASLRSALDRVGIDPSPSLVQAVFDHFDSSPKLLHT 107