BLASTX nr result
ID: Rehmannia26_contig00032594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00032594 (543 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_196675.1| phospholipase-like (PEARLI 4) family protein [A... 55 8e-06 >ref|NP_196675.1| phospholipase-like (PEARLI 4) family protein [Arabidopsis thaliana] gi|8953376|emb|CAB96649.1| putative protein [Arabidopsis thaliana] gi|60547893|gb|AAX23910.1| hypothetical protein At5g11140 [Arabidopsis thaliana] gi|332004255|gb|AED91638.1| phospholipase-like (PEARLI 4) family protein [Arabidopsis thaliana] Length = 241 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/115 (27%), Positives = 58/115 (50%) Frame = +1 Query: 178 IKQIFIKYGDVTKGSLLQSLEAKTAFLQLVAEVVERLHSHTISTIDAYEMQLIQKWTDDA 357 ++ IF KYGD+T S LQSL +T L+ +AEVV L S + + I DD Sbjct: 72 LQSIFDKYGDITSNSKLQSLSTRTYHLETLAEVVIELQSTPLRRLSESRATEILAIVDDI 131 Query: 358 AAVGFHVEWLQQRIKKIVTISKYRDSLMRLNEINEKINAAKIALSRMELQQMILK 522 V WL+ +++++ ++Y D + + +K ++ L++ E++ + K Sbjct: 132 ETAKIRVGWLRSVLEEVLEATRYFDR-CEMAVMEKKAGEHRLLLAKQEMELSLKK 185