BLASTX nr result
ID: Rehmannia26_contig00031787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031787 (599 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Popu... 64 4e-08 gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] 59 8e-07 gb|EMJ07400.1| hypothetical protein PRUPE_ppa014907mg, partial [... 57 3e-06 gb|ESW34747.1| hypothetical protein PHAVU_001G177600g [Phaseolus... 56 6e-06 >ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] gi|550336146|gb|ERP59240.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] Length = 77 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 219 MGYIVVVSLPVILFFLITAIACYLFGRARGRRENVRLPQYY 341 MGY+V+VSLPVILF LI A+A YL GRARGR E R+PQY+ Sbjct: 1 MGYVVIVSLPVILFILIVALAFYLLGRARGRSEAARIPQYH 41 >gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] Length = 61 Score = 59.3 bits (142), Expect = 8e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 219 MGYIVVVSLPVILFFLITAIACYLFGRARGRRENVRLPQYY 341 MGYIVV+S+PVILF LI A+A YL GRARGR + +PQYY Sbjct: 1 MGYIVVLSVPVILFILIVALAFYLLGRARGRSQAESVPQYY 41 >gb|EMJ07400.1| hypothetical protein PRUPE_ppa014907mg, partial [Prunus persica] Length = 98 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +3 Query: 216 KMGYIVVVSLPVILFFLITAIACYLFGRARGRRENVRLPQYY 341 KMGY+VVVS+PVILF +I A+A YL GRA GRRE V Q++ Sbjct: 40 KMGYVVVVSVPVILFIVIVALAFYLIGRANGRREAVSAQQHF 81 >gb|ESW34747.1| hypothetical protein PHAVU_001G177600g [Phaseolus vulgaris] Length = 50 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 219 MGYIVVVSLPVILFFLITAIACYLFGRARGRRENVRLPQYY 341 MG++VV+SLP+ILF LI A+ CY+ GRA+GRR+N PQ Y Sbjct: 1 MGFVVVISLPLILFILILALVCYMLGRAKGRRQN---PQQY 38