BLASTX nr result
ID: Rehmannia26_contig00031317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031317 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB70677.1| hypothetical protein L484_023863 [Morus notabilis] 58 1e-06 >gb|EXB70677.1| hypothetical protein L484_023863 [Morus notabilis] Length = 684 Score = 57.8 bits (138), Expect = 1e-06 Identities = 33/91 (36%), Positives = 47/91 (51%) Frame = -1 Query: 304 KNLQPNITYSSTTSIYAENELEKFLYVKLNRLYTAAHKWLLTLGYSNEEVETAILNAGYV 125 K Q + + + +E ELE L KL +Y A L++ GY + V AIL GYV Sbjct: 61 KPTQSSSPFVNNPMYCSEEELENMLLNKLEIIYKQAIAKLMSFGYPRDVVWNAILTCGYV 120 Query: 124 HGEMDFLNNITTNSVGFIEEEFNPKREAFKD 32 G+ D L NI NSV +I+ + + + E KD Sbjct: 121 FGDEDILTNIVQNSVEYIKTKKSKRNETHKD 151