BLASTX nr result
ID: Rehmannia26_contig00031261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00031261 (566 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006424719.1| hypothetical protein CICLE_v10027823mg [Citr... 57 3e-06 ref|XP_004294627.1| PREDICTED: receptor-like protein kinase HERK... 57 3e-06 ref|XP_002298383.2| kinase family protein [Populus trichocarpa] ... 55 9e-06 >ref|XP_006424719.1| hypothetical protein CICLE_v10027823mg [Citrus clementina] gi|567864142|ref|XP_006424720.1| hypothetical protein CICLE_v10027823mg [Citrus clementina] gi|568870064|ref|XP_006488232.1| PREDICTED: receptor-like protein kinase HERK 1-like [Citrus sinensis] gi|557526653|gb|ESR37959.1| hypothetical protein CICLE_v10027823mg [Citrus clementina] gi|557526654|gb|ESR37960.1| hypothetical protein CICLE_v10027823mg [Citrus clementina] Length = 828 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 119 FDPVDQYYINCGSSTDVVVGNTTYVADSSASRYLSTPQD 3 FDP D Y I+CGS T+ VGN +VAD+SAS++LSTPQ+ Sbjct: 28 FDPADNYLIDCGSRTNTTVGNRVFVADNSASKFLSTPQN 66 >ref|XP_004294627.1| PREDICTED: receptor-like protein kinase HERK 1-like [Fragaria vesca subsp. vesca] Length = 833 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -1 Query: 122 GFDPVDQYYINCGSSTDVVVGNTTYVADSSASRYLSTPQD 3 GF PVD Y+I+CGS T+ VGN Y+AD AS++LSTP+D Sbjct: 25 GFTPVDNYFIDCGSPTNTSVGNRVYLADKLASKFLSTPKD 64 >ref|XP_002298383.2| kinase family protein [Populus trichocarpa] gi|550348057|gb|EEE83188.2| kinase family protein [Populus trichocarpa] Length = 833 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -1 Query: 122 GFDPVDQYYINCGSSTDVVVGNTTYVADSSASRYLSTPQD 3 GF PVD Y I+CGS T+ VGN +VAD+SAS +LSTP++ Sbjct: 26 GFTPVDNYLIDCGSLTNTTVGNRVFVADNSASNFLSTPKN 65