BLASTX nr result
ID: Rehmannia26_contig00029769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00029769 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527183.1| hypothetical protein RCOM_1074840 [Ricinus c... 55 1e-05 >ref|XP_002527183.1| hypothetical protein RCOM_1074840 [Ricinus communis] gi|223533448|gb|EEF35196.1| hypothetical protein RCOM_1074840 [Ricinus communis] Length = 339 Score = 55.1 bits (131), Expect = 1e-05 Identities = 20/62 (32%), Positives = 44/62 (70%) Frame = +1 Query: 202 SKNSNLDGNSTIVEGLSLLFALQSACTAGIQGIHVESDCKVIIDGIQGKEISDPHGDLLI 381 ++ ++G++ + E L++ +AL++ C +GI+ I +E+DCK++IDG+ K + +G++L+ Sbjct: 252 ARRVQMEGSTVVAEALTIRWALETICASGIRDIIMENDCKIVIDGLNDKGCPEIYGEMLL 311 Query: 382 DD 387 D Sbjct: 312 PD 313