BLASTX nr result
ID: Rehmannia26_contig00029588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00029588 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67073.1| hypothetical protein M569_07705, partial [Genlise... 72 8e-11 >gb|EPS67073.1| hypothetical protein M569_07705, partial [Genlisea aurea] Length = 355 Score = 72.0 bits (175), Expect = 8e-11 Identities = 44/86 (51%), Positives = 52/86 (60%), Gaps = 1/86 (1%) Frame = -1 Query: 291 MKPEPGLEIERLGQLQGSERGSGSSDPTRPDSNGSEWVDCCNVLRVRPSEANGFAVYTRN 112 MKPE G EIE G +GS+ DP R + + S+W+D C RVR SEA GFAVYTR Sbjct: 1 MKPELGSEIECSGPSKGSDEQQ--PDPARDNLDDSDWLDRCYTSRVRESEAKGFAVYTRK 58 Query: 111 KRLKSRSVG-RIGYLDKLQGKSGVLV 37 KRLKS VG + + K Q S VLV Sbjct: 59 KRLKSAEVGATVCFEKKNQSDSRVLV 84