BLASTX nr result
ID: Rehmannia26_contig00029455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00029455 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382170.1| hypothetical protein POPTR_0006s29040g [Popu... 60 3e-07 ref|NP_196625.2| putative translation elongation factor 2EF1A / ... 55 7e-06 emb|CAB89379.1| putative protein [Arabidopsis thaliana] 55 7e-06 ref|NP_001190282.1| putative translation elongation factor 2EF1A... 55 7e-06 >ref|XP_006382170.1| hypothetical protein POPTR_0006s29040g [Populus trichocarpa] gi|550337325|gb|ERP59967.1| hypothetical protein POPTR_0006s29040g [Populus trichocarpa] Length = 671 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = -2 Query: 314 APFKFDAPSPDDLVSIGLQSVKLKSKGNASREREMDIPVKSAVAAKGSESSSASVTRGR- 138 APFKFD PSPDD+VS GL+S K+ SK N R + + K S+ SSAS+ +G+ Sbjct: 81 APFKFDFPSPDDMVSKGLRSSKIGSKANLINSRSQNASAGISETVKSSDKSSASIPKGKQ 140 Query: 137 -RNGVNEND 114 R GV+E + Sbjct: 141 GRPGVDEGN 149 >ref|NP_196625.2| putative translation elongation factor 2EF1A / eIF-2-gamma [Arabidopsis thaliana] gi|222422871|dbj|BAH19422.1| AT5G10630 [Arabidopsis thaliana] gi|332004191|gb|AED91574.1| putative translation elongation factor 2EF1A / eIF-2-gamma [Arabidopsis thaliana] Length = 667 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 3/72 (4%) Frame = -2 Query: 314 APFKFDAPSPDDLVSIGLQSVKLKSKGN---ASREREMDIPVKSAVAAKGSESSSASVTR 144 APFKFDAPSPDDLVS GL S K KG+ + R++E V+ KG +SS S +R Sbjct: 89 APFKFDAPSPDDLVSNGLTSSKTGPKGSGDASMRQKEKQDSVEQKPLKKGGDSSETS-SR 147 Query: 143 GRRNGVNENDSA 108 GR + +++ A Sbjct: 148 GRHDKLDDKGGA 159 >emb|CAB89379.1| putative protein [Arabidopsis thaliana] Length = 804 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 3/72 (4%) Frame = -2 Query: 314 APFKFDAPSPDDLVSIGLQSVKLKSKGN---ASREREMDIPVKSAVAAKGSESSSASVTR 144 APFKFDAPSPDDLVS GL S K KG+ + R++E V+ KG +SS S +R Sbjct: 226 APFKFDAPSPDDLVSNGLTSSKTGPKGSGDASMRQKEKQDSVEQKPLKKGGDSSETS-SR 284 Query: 143 GRRNGVNENDSA 108 GR + +++ A Sbjct: 285 GRHDKLDDKGGA 296 >ref|NP_001190282.1| putative translation elongation factor 2EF1A / eIF-2-gamma [Arabidopsis thaliana] gi|332004192|gb|AED91575.1| putative translation elongation factor 2EF1A / eIF-2-gamma [Arabidopsis thaliana] Length = 668 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 3/72 (4%) Frame = -2 Query: 314 APFKFDAPSPDDLVSIGLQSVKLKSKGN---ASREREMDIPVKSAVAAKGSESSSASVTR 144 APFKFDAPSPDDLVS GL S K KG+ + R++E V+ KG +SS S +R Sbjct: 90 APFKFDAPSPDDLVSNGLTSSKTGPKGSGDASMRQKEKQDSVEQKPLKKGGDSSETS-SR 148 Query: 143 GRRNGVNENDSA 108 GR + +++ A Sbjct: 149 GRHDKLDDKGGA 160