BLASTX nr result
ID: Rehmannia26_contig00029186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00029186 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [... 40 7e-07 >ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula] gi|355504386|gb|AES85589.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula] Length = 1458 Score = 40.0 bits (92), Expect(2) = 7e-07 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = -3 Query: 331 FILVDLSPQPNSRPDNVSYPYRPAEASIGPKR 236 ++L D+ PQPNS PDNV P RP + +G K+ Sbjct: 241 YLLTDVPPQPNSPPDNVFRPDRPTKVGLGSKK 272 Score = 38.5 bits (88), Expect(2) = 7e-07 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 245 SKKRSISPPTIHEISEIMLKVVVFH 171 SKKR +PP IH IS+I LKVVVFH Sbjct: 270 SKKRGSAPPPIHGISKITLKVVVFH 294