BLASTX nr result
ID: Rehmannia26_contig00029166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00029166 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279219.1| PREDICTED: AUX-1-like protein [Vitis vinifer... 65 1e-08 emb|CAN72381.1| hypothetical protein VITISV_038019 [Vitis vinifera] 65 1e-08 dbj|BAC98948.1| AUX1-like auxin influx carrier protein [Pisum sa... 64 2e-08 gb|ABN81349.1| auxin influx transport protein [Casuarina glauca]... 64 2e-08 ref|XP_002879837.1| auxin influx transport protein [Arabidopsis ... 64 3e-08 dbj|BAH47612.1| auxin influx carrier protein [Zinnia violacea] 63 3e-08 ref|XP_006602646.1| PREDICTED: auxin transporter-like protein 2-... 62 8e-08 ref|NP_974719.1| auxin transporter-like protein 1 [Arabidopsis t... 62 1e-07 ref|NP_195744.1| auxin transporter-like protein 1 [Arabidopsis t... 62 1e-07 ref|XP_003623228.1| Auxin transporter-like protein [Medicago tru... 62 1e-07 emb|CAB55758.1| putative AUX1-like permease [Arabidopsis thaliana] 62 1e-07 ref|XP_002873019.1| hypothetical protein ARALYDRAFT_486953 [Arab... 62 1e-07 ref|XP_006480987.1| PREDICTED: auxin transporter-like protein 2-... 61 1e-07 ref|XP_006429325.1| hypothetical protein CICLE_v10011596mg [Citr... 61 1e-07 gb|EOY07264.1| Transmembrane amino acid transporter family prote... 61 1e-07 ref|XP_006287618.1| hypothetical protein CARUB_v10000830mg [Caps... 61 1e-07 ref|XP_004302648.1| PREDICTED: auxin transporter-like protein 2-... 61 1e-07 gb|EMJ06325.1| hypothetical protein PRUPE_ppa004949mg [Prunus pe... 61 1e-07 gb|ABQ95665.1| auxin influx carrier, partial [Malus domestica] 61 1e-07 sp|Q8L884.1|LAX4_MEDTR RecName: Full=Auxin transporter-like prot... 61 1e-07 >ref|XP_002279219.1| PREDICTED: AUX-1-like protein [Vitis vinifera] gi|297740231|emb|CBI30413.3| unnamed protein product [Vitis vinifera] Length = 478 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPPRH 121 WASM NF++QVDTFGLFAKCYQCKPP P+H Sbjct: 442 WASMTNFVRQVDTFGLFAKCYQCKPPTPQH 471 >emb|CAN72381.1| hypothetical protein VITISV_038019 [Vitis vinifera] Length = 478 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPPRH 121 WASM NF++QVDTFGLFAKCYQCKPP P+H Sbjct: 442 WASMTNFVRQVDTFGLFAKCYQCKPPTPQH 471 >dbj|BAC98948.1| AUX1-like auxin influx carrier protein [Pisum sativum] gi|224434586|dbj|BAH23797.1| putative auxin transport facilitator protein [Pisum sativum] Length = 487 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NFI+Q+DTFGLFAKCYQCKPPPP Sbjct: 447 WASMTNFIRQIDTFGLFAKCYQCKPPPP 474 >gb|ABN81349.1| auxin influx transport protein [Casuarina glauca] gi|126217794|gb|ABN81350.1| auxin influx transport protein [Casuarina glauca] Length = 480 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NF++QVDTFGLFAKCYQCKPPPP Sbjct: 443 WASMTNFVRQVDTFGLFAKCYQCKPPPP 470 >ref|XP_002879837.1| auxin influx transport protein [Arabidopsis lyrata subsp. lyrata] gi|297325676|gb|EFH56096.1| auxin influx transport protein [Arabidopsis lyrata subsp. lyrata] Length = 466 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPPRH 121 WASM NFIKQVDTFGLFAKCYQC PP P H Sbjct: 437 WASMTNFIKQVDTFGLFAKCYQCPPPQPHH 466 >dbj|BAH47612.1| auxin influx carrier protein [Zinnia violacea] Length = 476 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPPRH 121 WASM NFI QVDTFGLFAKCYQCKPP P H Sbjct: 445 WASMTNFIDQVDTFGLFAKCYQCKPPTPTH 474 >ref|XP_006602646.1| PREDICTED: auxin transporter-like protein 2-like isoform X2 [Glycine max] gi|571547425|ref|XP_006602647.1| PREDICTED: auxin transporter-like protein 2-like isoform X3 [Glycine max] gi|571547429|ref|XP_003552233.2| PREDICTED: auxin transporter-like protein 2-like isoform X1 [Glycine max] Length = 494 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NF+KQ+DTFGLFAKCYQCKPP P Sbjct: 452 WASMTNFVKQIDTFGLFAKCYQCKPPTP 479 >ref|NP_974719.1| auxin transporter-like protein 1 [Arabidopsis thaliana] gi|332002933|gb|AED90316.1| auxin transporter-like protein 1 [Arabidopsis thaliana] Length = 408 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPP 112 WASM NFI+Q+DTFGLFAKCYQCKPPP Sbjct: 371 WASMTNFIRQIDTFGLFAKCYQCKPPP 397 >ref|NP_195744.1| auxin transporter-like protein 1 [Arabidopsis thaliana] gi|75263850|sp|Q9LFB2.1|LAX1_ARATH RecName: Full=Auxin transporter-like protein 1; AltName: Full=AUX1-like protein 1 gi|6759447|emb|CAB69852.1| LAX1 / AUX1-like permease [Arabidopsis thaliana] gi|332002932|gb|AED90315.1| auxin transporter-like protein 1 [Arabidopsis thaliana] Length = 488 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPP 112 WASM NFI+Q+DTFGLFAKCYQCKPPP Sbjct: 451 WASMTNFIRQIDTFGLFAKCYQCKPPP 477 >ref|XP_003623228.1| Auxin transporter-like protein [Medicago truncatula] gi|75262336|sp|Q9FEL7.1|LAX2_MEDTR RecName: Full=Auxin transporter-like protein 2; AltName: Full=AUX1-like protein 2; AltName: Full=MtLAX2 gi|10800920|emb|CAC12996.1| putative AUX1-like permease [Medicago truncatula] gi|21586462|gb|AAM55304.1| auxin influx carrier protein [Medicago truncatula] gi|355498243|gb|AES79446.1| Auxin transporter-like protein [Medicago truncatula] Length = 484 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPP 112 WASM NFI+Q+DTFGLFAKCYQCKPPP Sbjct: 445 WASMTNFIRQIDTFGLFAKCYQCKPPP 471 >emb|CAB55758.1| putative AUX1-like permease [Arabidopsis thaliana] Length = 485 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPP 112 WASM NFI+Q+DTFGLFAKCYQCKPPP Sbjct: 448 WASMTNFIRQIDTFGLFAKCYQCKPPP 474 >ref|XP_002873019.1| hypothetical protein ARALYDRAFT_486953 [Arabidopsis lyrata subsp. lyrata] gi|297318856|gb|EFH49278.1| hypothetical protein ARALYDRAFT_486953 [Arabidopsis lyrata subsp. lyrata] Length = 488 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPP 112 WASM NFI+Q+DTFGLFAKCYQCKPPP Sbjct: 451 WASMTNFIRQIDTFGLFAKCYQCKPPP 477 >ref|XP_006480987.1| PREDICTED: auxin transporter-like protein 2-like [Citrus sinensis] Length = 487 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WAS+ NF++QVD+FGLFAKCYQCKPPPP Sbjct: 449 WASVTNFVRQVDSFGLFAKCYQCKPPPP 476 >ref|XP_006429325.1| hypothetical protein CICLE_v10011596mg [Citrus clementina] gi|557531382|gb|ESR42565.1| hypothetical protein CICLE_v10011596mg [Citrus clementina] Length = 487 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WAS+ NF++QVD+FGLFAKCYQCKPPPP Sbjct: 449 WASVTNFVRQVDSFGLFAKCYQCKPPPP 476 >gb|EOY07264.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] gi|508715368|gb|EOY07265.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] Length = 480 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NFI+Q+DTFGLFAKCYQCKPP P Sbjct: 444 WASMTNFIRQIDTFGLFAKCYQCKPPTP 471 >ref|XP_006287618.1| hypothetical protein CARUB_v10000830mg [Capsella rubella] gi|482556324|gb|EOA20516.1| hypothetical protein CARUB_v10000830mg [Capsella rubella] Length = 488 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NFI+Q++TFGLFA+CYQCKPPPP Sbjct: 450 WASMTNFIRQINTFGLFARCYQCKPPPP 477 >ref|XP_004302648.1| PREDICTED: auxin transporter-like protein 2-like [Fragaria vesca subsp. vesca] Length = 484 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NF++QVDTFGLFAKCYQCKPP P Sbjct: 449 WASMTNFVRQVDTFGLFAKCYQCKPPTP 476 >gb|EMJ06325.1| hypothetical protein PRUPE_ppa004949mg [Prunus persica] Length = 484 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NF++QVDTFGLFAKCYQCKPP P Sbjct: 448 WASMTNFVRQVDTFGLFAKCYQCKPPKP 475 >gb|ABQ95665.1| auxin influx carrier, partial [Malus domestica] Length = 366 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NF++QVDTFGLFAKCYQCKPP P Sbjct: 329 WASMTNFVRQVDTFGLFAKCYQCKPPKP 356 >sp|Q8L884.1|LAX4_MEDTR RecName: Full=Auxin transporter-like protein 4; AltName: Full=AUX1-like protein 4; AltName: Full=MtLAX4 gi|21586468|gb|AAM55305.1| auxin influx carrier protein [Medicago truncatula] Length = 482 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 32 WASMNNFIKQVDTFGLFAKCYQCKPPPP 115 WASM NFI+Q+DTFGLFAKCYQCKPP P Sbjct: 445 WASMTNFIRQIDTFGLFAKCYQCKPPTP 472