BLASTX nr result
ID: Rehmannia26_contig00029056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00029056 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73873.1| hypothetical protein M569_00882 [Genlisea aurea] 60 3e-07 ref|XP_002533779.1| Monoglyceride lipase, putative [Ricinus comm... 57 3e-06 gb|AAF25985.1|AC013354_4 F15H18.13 [Arabidopsis thaliana] 56 4e-06 >gb|EPS73873.1| hypothetical protein M569_00882 [Genlisea aurea] Length = 814 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 6/40 (15%) Frame = -2 Query: 103 HSLDYAVNHL------VLAENPTIPCFCF*HSTGGAIVLK 2 HSLDYAVN L VLAENP++PCFCF HSTGGAI+LK Sbjct: 620 HSLDYAVNDLKTYLANVLAENPSLPCFCFGHSTGGAIILK 659 >ref|XP_002533779.1| Monoglyceride lipase, putative [Ricinus communis] gi|223526300|gb|EEF28609.1| Monoglyceride lipase, putative [Ricinus communis] Length = 457 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 6/40 (15%) Frame = -2 Query: 103 HSLDYAVNHL------VLAENPTIPCFCF*HSTGGAIVLK 2 H+LDYAVN L VL ENP +PCFCF HSTGGAIVLK Sbjct: 254 HALDYAVNDLKSFLDKVLGENPGLPCFCFGHSTGGAIVLK 293 >gb|AAF25985.1|AC013354_4 F15H18.13 [Arabidopsis thaliana] Length = 333 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 100 SLDYAVNHLVLAENPTIPCFCF*HSTGGAIVLK 2 SLDYAV LV+AENP +PCFC HSTGGAI+LK Sbjct: 137 SLDYAVADLVIAENPGLPCFCIGHSTGGAIILK 169