BLASTX nr result
ID: Rehmannia26_contig00027923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027923 (358 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containi... 121 1e-25 gb|EMJ16874.1| hypothetical protein PRUPE_ppa003946mg [Prunus pe... 119 5e-25 ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 emb|CBI22243.3| unnamed protein product [Vitis vinifera] 117 2e-24 ref|XP_002324070.1| pentatricopeptide repeat-containing family p... 115 8e-24 ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 gb|EOY03520.1| Pentatricopeptide repeat (PPR) superfamily protei... 113 3e-23 ref|XP_006400050.1| hypothetical protein EUTSA_v10015396mg [Eutr... 107 2e-21 ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citr... 101 9e-20 ref|NP_197034.2| pentatricopeptide repeat-containing protein [Ar... 101 9e-20 emb|CAB89340.1| putative protein [Arabidopsis thaliana] 101 9e-20 ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_002873718.1| pentatricopeptide repeat-containing protein ... 99 5e-19 gb|EXB31944.1| hypothetical protein L484_013576 [Morus notabilis] 99 6e-19 ref|XP_006287429.1| hypothetical protein CARUB_v10000633mg [Caps... 97 2e-18 ref|XP_004232214.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 gb|AAL84319.1|AC073556_36 putative pentatricopeptide repeat cont... 94 2e-17 ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 >ref|XP_002283796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Vitis vinifera] Length = 550 Score = 121 bits (303), Expect = 1e-25 Identities = 59/86 (68%), Positives = 69/86 (80%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 RIH NVELGRRAN QLLK+R DESGDYVLLSNIYAS GEW G EKVR LMD++GV+KE G Sbjct: 457 RIHGNVELGRRANMQLLKMRHDESGDYVLLSNIYASRGEWDGVEKVRKLMDDSGVRKEAG 516 Query: 183 FSLVDEENNELLSFLLGSKPHANARE 260 SL++ +N L+ FL SKP N+R+ Sbjct: 517 CSLIEGDNKALMHFLFDSKPKLNSRK 542 >gb|EMJ16874.1| hypothetical protein PRUPE_ppa003946mg [Prunus persica] Length = 539 Score = 119 bits (297), Expect = 5e-25 Identities = 54/80 (67%), Positives = 70/80 (87%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H NVELGRRANE+LL++RRDESGD+VLLSNIYAS GEWRG E+VR LMD++GVKKE G Sbjct: 457 RVHGNVELGRRANERLLEMRRDESGDFVLLSNIYASRGEWRGVEEVRKLMDDSGVKKEPG 516 Query: 183 FSLVDEENNELLSFLLGSKP 242 +SL++ +N++L+ FL +P Sbjct: 517 YSLIETDNSDLMHFLFDYRP 536 >ref|XP_004170804.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like, partial [Cucumis sativus] Length = 315 Score = 117 bits (293), Expect = 2e-24 Identities = 56/81 (69%), Positives = 68/81 (83%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H +VELGRRANEQLLK+R+DESGDYVLLSNIYAS GEW G +KVR LMD+ GVKK+ G Sbjct: 230 RVHGDVELGRRANEQLLKMRKDESGDYVLLSNIYASQGEWDGVQKVRKLMDDGGVKKKVG 289 Query: 183 FSLVDEENNELLSFLLGSKPH 245 SL+D +N+ L+ FL SKP+ Sbjct: 290 HSLIDSDNSFLMHFLFDSKPN 310 >ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] Length = 542 Score = 117 bits (293), Expect = 2e-24 Identities = 56/81 (69%), Positives = 68/81 (83%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H +VELGRRANEQLLK+R+DESGDYVLLSNIYAS GEW G +KVR LMD+ GVKK+ G Sbjct: 457 RVHGDVELGRRANEQLLKMRKDESGDYVLLSNIYASQGEWDGVQKVRKLMDDGGVKKKVG 516 Query: 183 FSLVDEENNELLSFLLGSKPH 245 SL+D +N+ L+ FL SKP+ Sbjct: 517 HSLIDSDNSFLMHFLFDSKPN 537 >emb|CBI22243.3| unnamed protein product [Vitis vinifera] Length = 526 Score = 117 bits (293), Expect = 2e-24 Identities = 57/81 (70%), Positives = 66/81 (81%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 RIH NVELGRRAN QLLK+R DESGDYVLLSNIYAS GEW G EKVR LMD++GV+KE G Sbjct: 422 RIHGNVELGRRANMQLLKMRHDESGDYVLLSNIYASRGEWDGVEKVRKLMDDSGVRKEAG 481 Query: 183 FSLVDEENNELLSFLLGSKPH 245 SL++ +N L+ FL SKP+ Sbjct: 482 CSLIEGDNKALMHFLFDSKPN 502 >ref|XP_002324070.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222867072|gb|EEF04203.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 546 Score = 115 bits (287), Expect = 8e-24 Identities = 56/85 (65%), Positives = 68/85 (80%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H NVELGR ANE+LLKLRRDESGDYVLLSNIYAS GEW GAE+VR LMD+ GV+KE G Sbjct: 458 RVHGNVELGRLANERLLKLRRDESGDYVLLSNIYASAGEWDGAEEVRKLMDDGGVRKEAG 517 Query: 183 FSLVDEENNELLSFLLGSKPHANAR 257 SL++ ++ ++ FL KP N+R Sbjct: 518 RSLIEADDRAVMQFLFDPKPKLNSR 542 >ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Fragaria vesca subsp. vesca] Length = 540 Score = 114 bits (285), Expect = 1e-23 Identities = 55/83 (66%), Positives = 68/83 (81%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 ++H NVELGRRANE+LL++R DESGD+VLLSNIYAS GEW GAE+VR LMD++GVKKE G Sbjct: 457 KVHGNVELGRRANERLLEIRGDESGDFVLLSNIYASRGEWHGAEEVRKLMDDSGVKKEAG 516 Query: 183 FSLVDEENNELLSFLLGSKPHAN 251 FS+V+ + + L FLL SK N Sbjct: 517 FSMVEADGHALKHFLLDSKSKLN 539 >gb|EOY03520.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 549 Score = 113 bits (282), Expect = 3e-23 Identities = 56/85 (65%), Positives = 66/85 (77%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 RIH NVELGRRANE+LLK+RR++SGDYVLLSNIYAS GEW G EKVR +MD++GV KE G Sbjct: 459 RIHGNVELGRRANERLLKMRREQSGDYVLLSNIYASKGEWDGVEKVRKMMDDSGVTKEPG 518 Query: 183 FSLVDEENNELLSFLLGSKPHANAR 257 SL++ E L+ FL SK N R Sbjct: 519 CSLLEAEEKVLMHFLFDSKSKINLR 543 >ref|XP_006400050.1| hypothetical protein EUTSA_v10015396mg [Eutrema salsugineum] gi|557101140|gb|ESQ41503.1| hypothetical protein EUTSA_v10015396mg [Eutrema salsugineum] Length = 547 Score = 107 bits (266), Expect = 2e-21 Identities = 51/88 (57%), Positives = 71/88 (80%), Gaps = 1/88 (1%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 RI+ NVELG+ ANE+LL LR+DESGDYVLLSNIYAS GEW +KVR + D+TGVKK G Sbjct: 459 RIYGNVELGKYANEKLLSLRKDESGDYVLLSNIYASTGEWDRVQKVRKMFDDTGVKKPTG 518 Query: 183 FSLVDEENNEL-LSFLLGSKPHANAREA 263 +SL++E++++L + +LL S+P +N + + Sbjct: 519 YSLIEEDDDKLMMRYLLSSEPESNIKRS 546 >ref|XP_006431200.1| hypothetical protein CICLE_v10011436mg [Citrus clementina] gi|557533257|gb|ESR44440.1| hypothetical protein CICLE_v10011436mg [Citrus clementina] Length = 540 Score = 101 bits (252), Expect = 9e-20 Identities = 47/84 (55%), Positives = 63/84 (75%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H +VELGR AN++LL +R+DESGDYVLLSNIYAS GEW EKVR LMD++ +KK+ G Sbjct: 452 RVHGDVELGRLANKRLLNMRKDESGDYVLLSNIYASQGEWNRVEKVRKLMDDSDIKKQPG 511 Query: 183 FSLVDEENNELLSFLLGSKPHANA 254 SL++ ++ L +L KP N+ Sbjct: 512 CSLIEADDKAFLQYLFNLKPKPNS 535 >ref|NP_197034.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635759|sp|Q9LXF2.2|PP385_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15300 gi|332004762|gb|AED92145.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 548 Score = 101 bits (252), Expect = 9e-20 Identities = 48/86 (55%), Positives = 69/86 (80%), Gaps = 1/86 (1%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 +I+ NVELG+ ANE+LL +R+DESGDYVLLSNIYAS G+W G +KVR + D+T VKK G Sbjct: 459 KIYGNVELGKYANEKLLSMRKDESGDYVLLSNIYASTGQWDGVQKVRKMFDDTRVKKPTG 518 Query: 183 FSLVDEENNEL-LSFLLGSKPHANAR 257 SL++E++++L + +LL S+P + +R Sbjct: 519 VSLIEEDDDKLMMRYLLSSEPESRSR 544 >emb|CAB89340.1| putative protein [Arabidopsis thaliana] Length = 514 Score = 101 bits (252), Expect = 9e-20 Identities = 48/86 (55%), Positives = 69/86 (80%), Gaps = 1/86 (1%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 +I+ NVELG+ ANE+LL +R+DESGDYVLLSNIYAS G+W G +KVR + D+T VKK G Sbjct: 425 KIYGNVELGKYANEKLLSMRKDESGDYVLLSNIYASTGQWDGVQKVRKMFDDTRVKKPTG 484 Query: 183 FSLVDEENNEL-LSFLLGSKPHANAR 257 SL++E++++L + +LL S+P + +R Sbjct: 485 VSLIEEDDDKLMMRYLLSSEPESRSR 510 >ref|XP_006482626.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Citrus sinensis] Length = 540 Score = 100 bits (250), Expect = 2e-19 Identities = 47/84 (55%), Positives = 63/84 (75%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H +VELGR AN++LL +R+DESGDYVLLSNIYAS GEW EKVR LMD++ +KK+ G Sbjct: 452 RVHGDVELGRLANKRLLNMRKDESGDYVLLSNIYASQGEWNRVEKVRKLMDDSEIKKQPG 511 Query: 183 FSLVDEENNELLSFLLGSKPHANA 254 SL++ ++ L +L KP N+ Sbjct: 512 CSLIEADDKAFLQYLFNLKPMPNS 535 >ref|XP_006338776.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Solanum tuberosum] Length = 539 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/79 (60%), Positives = 61/79 (77%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 ++H NVELGR ANEQLLKL R++SGDYVLLSNIYAS EW G E+VR LMD+ GV KE G Sbjct: 457 KVHSNVELGRYANEQLLKLGREDSGDYVLLSNIYASRDEWDGVERVRKLMDDNGVWKEPG 516 Query: 183 FSLVDEENNELLSFLLGSK 239 +L++ ++ +L +F SK Sbjct: 517 CTLIEADDYDLKNFCFDSK 535 >ref|XP_002873718.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319555|gb|EFH49977.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 548 Score = 99.4 bits (246), Expect = 5e-19 Identities = 47/87 (54%), Positives = 69/87 (79%), Gaps = 1/87 (1%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 +I+ NVELG+ ANE+LL +R+DESGDYVLLSNIYAS G+W G +KVR + D+T VKK G Sbjct: 459 KIYGNVELGKYANEKLLSMRKDESGDYVLLSNIYASTGQWDGVQKVRKMFDDTRVKKPTG 518 Query: 183 FSLVDEENNEL-LSFLLGSKPHANARE 260 SL++E++++L + +LL S+ + +R+ Sbjct: 519 ISLIEEDDDKLMMRYLLSSEAESKSRK 545 >gb|EXB31944.1| hypothetical protein L484_013576 [Morus notabilis] Length = 512 Score = 99.0 bits (245), Expect = 6e-19 Identities = 48/79 (60%), Positives = 60/79 (75%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 RIH NVEL +RA+++LL++R +ESGDYVLLSNIYAS GEW GAEKVR MD++GV KE G Sbjct: 422 RIHGNVELAKRASDELLRMRTNESGDYVLLSNIYASQGEWNGAEKVRESMDKSGVMKEAG 481 Query: 183 FSLVDEENNELLSFLLGSK 239 SL++ N + FL K Sbjct: 482 CSLIEANNISVKQFLFDPK 500 >ref|XP_006287429.1| hypothetical protein CARUB_v10000633mg [Capsella rubella] gi|482556135|gb|EOA20327.1| hypothetical protein CARUB_v10000633mg [Capsella rubella] Length = 548 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/86 (53%), Positives = 67/86 (77%), Gaps = 1/86 (1%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 +I+ NVELG+ ANE+LL +R+DESGDYVLLSNIYAS GEW +KVR + D+T VKK G Sbjct: 459 KIYGNVELGKYANERLLSMRKDESGDYVLLSNIYASTGEWEAVQKVRKMFDDTRVKKPTG 518 Query: 183 FSLVDEENNEL-LSFLLGSKPHANAR 257 S+++E++++L + +LL S+ + +R Sbjct: 519 ISVIEEDDDKLMMRYLLASESESRSR 544 >ref|XP_004232214.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Solanum lycopersicum] Length = 539 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/79 (58%), Positives = 61/79 (77%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 ++H NV+LGR AN+QLLKL R++SGDYVLLSNIYAS EW G E+VR LMD+ GV KE G Sbjct: 457 KVHSNVKLGRYANKQLLKLGREDSGDYVLLSNIYASRDEWDGVERVRKLMDDNGVWKEPG 516 Query: 183 FSLVDEENNELLSFLLGSK 239 +L++ ++ +L +F SK Sbjct: 517 CTLIEADDYDLKNFYFDSK 535 >gb|AAL84319.1|AC073556_36 putative pentatricopeptide repeat containing protein [Oryza sativa Japonica Group] Length = 545 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/85 (52%), Positives = 59/85 (69%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 R+H +EL + AN QLLK R DESGDYVLLSNIYAS GEW G+EK+R LMD++GV KE G Sbjct: 457 RVHGEIELAKHANRQLLKARNDESGDYVLLSNIYASVGEWFGSEKMRKLMDDSGVNKEAG 516 Query: 183 FSLVDEENNELLSFLLGSKPHANAR 257 + VD +++ S+ H+ + Sbjct: 517 QTFVDGSVKDIIQSFGQSRSHSERK 541 >ref|XP_003551738.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Glycine max] Length = 518 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/65 (66%), Positives = 53/65 (81%) Frame = +3 Query: 3 RIHCNVELGRRANEQLLKLRRDESGDYVLLSNIYASNGEWRGAEKVRTLMDETGVKKERG 182 ++H +VEL +RANEQLL++R D+SGDYVLLSN+YAS GEW GAE VR LMD+ GV K RG Sbjct: 451 KVHGDVELAKRANEQLLRMRGDQSGDYVLLSNVYASQGEWDGAENVRKLMDDNGVTKNRG 510 Query: 183 FSLVD 197 S V+ Sbjct: 511 SSFVE 515