BLASTX nr result
ID: Rehmannia26_contig00027890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027890 (559 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25612.3| unnamed protein product [Vitis vinifera] 56 7e-06 ref|XP_002264438.1| PREDICTED: uncharacterized protein LOC100248... 56 7e-06 >emb|CBI25612.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 425 LQHGPKERHLCVDIYDEXXXXXXXXXXXXXLLHPYSPKVKLLWRG 559 LQH KE +C+DIYDE LLHPYSPK KLLWRG Sbjct: 66 LQHSSKELRVCIDIYDEVGIGGGASGVSGGLLHPYSPKAKLLWRG 110 >ref|XP_002264438.1| PREDICTED: uncharacterized protein LOC100248232 [Vitis vinifera] Length = 450 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 425 LQHGPKERHLCVDIYDEXXXXXXXXXXXXXLLHPYSPKVKLLWRG 559 LQH KE +C+DIYDE LLHPYSPK KLLWRG Sbjct: 66 LQHSSKELRVCIDIYDEVGIGGGASGVSGGLLHPYSPKAKLLWRG 110