BLASTX nr result
ID: Rehmannia26_contig00027714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027714 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002586737.1| hypothetical protein BRAFLDRAFT_105734 [Bran... 61 2e-07 ref|XP_002609899.1| hypothetical protein BRAFLDRAFT_90718 [Branc... 57 2e-06 >ref|XP_002586737.1| hypothetical protein BRAFLDRAFT_105734 [Branchiostoma floridae] gi|229271861|gb|EEN42748.1| hypothetical protein BRAFLDRAFT_105734 [Branchiostoma floridae] Length = 2532 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/67 (37%), Positives = 34/67 (50%) Frame = -2 Query: 434 SGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAA 255 +G G GP G+ +GPT + GP G S G G+ +G TG GPTG+ Sbjct: 1648 NGSGDYGPNGSGDYGPTGSGDYGPNGSGDYGSHGSGDYGPNGSGDYGPTGSGDYGPTGSG 1707 Query: 254 SFGPTGA 234 +GPTG+ Sbjct: 1708 DYGPTGS 1714 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/70 (32%), Positives = 32/70 (45%) Frame = -2 Query: 443 FRSSGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPT 264 + S G G GP G+ +GP + GP G TG G+ +G G GP Sbjct: 1629 YGSHGSGDYGPNGSGDYGPNGSGDYGPNGSGDYGPTGSGDYGPNGSGDYGSHGSGDYGPN 1688 Query: 263 GAASFGPTGA 234 G+ +GPTG+ Sbjct: 1689 GSGDYGPTGS 1698 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/67 (34%), Positives = 32/67 (47%) Frame = -2 Query: 434 SGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAA 255 +G G GP G+ +GP + GP G G S G+ +G G GPTG+ Sbjct: 1640 NGSGDYGPNGSGDYGPNGSGDYGPTGSGDYGPNGSGDYGSHGSGDYGPNGSGDYGPTGSG 1699 Query: 254 SFGPTGA 234 +GPTG+ Sbjct: 1700 DYGPTGS 1706 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/67 (34%), Positives = 32/67 (47%) Frame = -2 Query: 434 SGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAA 255 +G G GP G+ +GPT + GP G S G G+ +G G GP G+ Sbjct: 1600 NGSGDYGPSGSGDYGPTGSGDYGPTGSGDYGSHGSGDYGPNGSGDYGPNGSGDYGPNGSG 1659 Query: 254 SFGPTGA 234 +GPTG+ Sbjct: 1660 DYGPTGS 1666 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/67 (34%), Positives = 32/67 (47%) Frame = -2 Query: 434 SGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAA 255 +G G GP G+ +G + GP G TG TG+ +G TG GP G+ Sbjct: 1664 TGSGDYGPNGSGDYGSHGSGDYGPNGSGDYGPTGSGDYGPTGSGDYGPTGSGDYGPNGSG 1723 Query: 254 SFGPTGA 234 +GPTG+ Sbjct: 1724 DYGPTGS 1730 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/67 (32%), Positives = 31/67 (46%) Frame = -2 Query: 434 SGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAA 255 +G G GP G+ +GP + GP G TG TG+ +G G GP G+ Sbjct: 1584 NGSGDYGPNGSGDYGPNGSGDYGPSGSGDYGPTGSGDYGPTGSGDYGSHGSGDYGPNGSG 1643 Query: 254 SFGPTGA 234 +GP G+ Sbjct: 1644 DYGPNGS 1650 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = -2 Query: 434 SGCGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAA 255 +G G GP G+ +GP+ + GP G TG S G+ +G G GP G+ Sbjct: 1592 NGSGDYGPNGSGDYGPSGSGDYGPTGSGDYGPTGSGDYGSHGSGDYGPNGSGDYGPNGSG 1651 Query: 254 SFGPTGA 234 +GP G+ Sbjct: 1652 DYGPNGS 1658 >ref|XP_002609899.1| hypothetical protein BRAFLDRAFT_90718 [Branchiostoma floridae] gi|229295261|gb|EEN65909.1| hypothetical protein BRAFLDRAFT_90718 [Branchiostoma floridae] Length = 159 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = -2 Query: 428 CGSIGPRGAASFGPTWDTNVGPRGDASVCSTGGASIDSTGAASFGQTGGASIGPTGAASF 249 C S GP G+ + GPT N+GP G + TG + TG+ + G TG + GPTG+ + Sbjct: 56 CNS-GPDGSCNSGPTGSCNIGPDGSCNSGPTGSCNSGPTGSCNSGPTGSCNSGPTGSCNS 114 Query: 248 GPTGA 234 GPTG+ Sbjct: 115 GPTGS 119