BLASTX nr result
ID: Rehmannia26_contig00027546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027546 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70888.1| hypothetical protein VITISV_005593 [Vitis vinifera] 89 6e-16 gb|EMJ09426.1| hypothetical protein PRUPE_ppa018422mg, partial [... 89 8e-16 gb|ADN33758.1| retrotransposon protein putative ty3-gypsy sub-cl... 88 1e-15 ref|XP_006359105.1| PREDICTED: uncharacterized protein LOC102581... 88 1e-15 ref|XP_002323146.1| predicted protein [Populus trichocarpa] 88 1e-15 ref|XP_006370558.1| hypothetical protein POPTR_0001s437701g, par... 87 2e-15 ref|XP_002334646.1| predicted protein [Populus trichocarpa] 87 2e-15 gb|EMJ12132.1| hypothetical protein PRUPE_ppa025679mg [Prunus pe... 87 2e-15 gb|ADN34247.1| ty3-gypsy retrotransposon protein [Cucumis melo s... 87 2e-15 ref|XP_006371784.1| hypothetical protein POPTR_0018s03280g, part... 86 5e-15 emb|CAN75115.1| hypothetical protein VITISV_002418 [Vitis vinifera] 86 5e-15 gb|EMJ02808.1| hypothetical protein PRUPE_ppa019755mg [Prunus pe... 86 7e-15 gb|EMJ00639.1| hypothetical protein PRUPE_ppa026673mg [Prunus pe... 86 7e-15 gb|ADN33709.1| retrotransposon gag protein [Cucumis melo subsp. ... 86 7e-15 emb|CAN74520.1| hypothetical protein VITISV_011170 [Vitis vinifera] 86 7e-15 ref|XP_002314375.1| predicted protein [Populus trichocarpa] 85 9e-15 emb|CAN68664.1| hypothetical protein VITISV_004416 [Vitis vinifera] 83 3e-14 ref|XP_002333404.1| predicted protein [Populus trichocarpa] 82 1e-13 gb|EMJ14028.1| hypothetical protein PRUPE_ppa020726mg [Prunus pe... 81 2e-13 gb|ABM55241.1| retrotransposon protein [Beta vulgaris] 80 3e-13 >emb|CAN70888.1| hypothetical protein VITISV_005593 [Vitis vinifera] Length = 683 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD+LSE S +EMCIQGMHW L YILQGIRP+TFEELATRAH +E+++ Sbjct: 253 LSLDCKDRLSEVSTVEMCIQGMHWDLLYILQGIRPRTFEELATRAHDMELNI 304 >gb|EMJ09426.1| hypothetical protein PRUPE_ppa018422mg, partial [Prunus persica] Length = 536 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD++SE SA+EMCIQGMHWSL YILQGI+P+TFEEL TR H IE+S+ Sbjct: 349 LSLDCKDRVSELSAVEMCIQGMHWSLLYILQGIKPRTFEELTTRVHDIELSI 400 >gb|ADN33758.1| retrotransposon protein putative ty3-gypsy sub-class [Cucumis melo subsp. melo] Length = 264 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD+LSE SA+EMC QGMHW L YILQGI+P+TFEELATRAH +E+S+ Sbjct: 116 LSLDCKDRLSELSAVEMCTQGMHWGLLYILQGIKPRTFEELATRAHDMELSI 167 >ref|XP_006359105.1| PREDICTED: uncharacterized protein LOC102581575, partial [Solanum tuberosum] Length = 910 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = -3 Query: 314 SLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISLN 159 SLNCKD+LSEAS IEM IQGMHW L YILQGI+PKTFEELATRAH +E+S++ Sbjct: 340 SLNCKDRLSEASGIEMYIQGMHWGLRYILQGIKPKTFEELATRAHDMELSMS 391 >ref|XP_002323146.1| predicted protein [Populus trichocarpa] Length = 789 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSLNC+D+L+E SA++MCIQGMHW L YILQGI+PK+FEELATRAH +E+S+ Sbjct: 268 LSLNCRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHKMELSI 319 >ref|XP_006370558.1| hypothetical protein POPTR_0001s437701g, partial [Populus trichocarpa] gi|550349763|gb|ERP67127.1| hypothetical protein POPTR_0001s437701g, partial [Populus trichocarpa] Length = 578 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSLNC+D+L+E SA++MCIQGMHW L YILQGI+PK+FEELATRAH +E+S+ Sbjct: 31 LSLNCRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELSI 82 >ref|XP_002334646.1| predicted protein [Populus trichocarpa] Length = 572 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSLNC+D+L+E SA++MCIQGMHW L YILQGI+PK+FEELATRAH +E+S+ Sbjct: 25 LSLNCRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELSI 76 >gb|EMJ12132.1| hypothetical protein PRUPE_ppa025679mg [Prunus persica] Length = 524 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/52 (73%), Positives = 47/52 (90%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD++S+ SA+EMCIQGMHW L YILQGI+P+TFEEL TRAH IE+S+ Sbjct: 245 LSLDCKDRVSKLSAVEMCIQGMHWGLLYILQGIKPRTFEELTTRAHDIELSI 296 >gb|ADN34247.1| ty3-gypsy retrotransposon protein [Cucumis melo subsp. melo] Length = 517 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/52 (73%), Positives = 47/52 (90%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD+L+E SA+EMC QGMHW L YILQGI+P+TFEELATRAH +E+S+ Sbjct: 314 LSLDCKDKLTELSAVEMCTQGMHWELLYILQGIKPRTFEELATRAHDMELSI 365 >ref|XP_006371784.1| hypothetical protein POPTR_0018s03280g, partial [Populus trichocarpa] gi|550317934|gb|ERP49581.1| hypothetical protein POPTR_0018s03280g, partial [Populus trichocarpa] Length = 440 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSLNC+D+L+E SA++MCIQGMHW L YILQGI+PK+FEELAT+AH +E+S+ Sbjct: 25 LSLNCRDRLTETSALDMCIQGMHWGLHYILQGIKPKSFEELATQAHDMELSI 76 >emb|CAN75115.1| hypothetical protein VITISV_002418 [Vitis vinifera] Length = 127 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD+LS+ SA+EMCIQGMHW YI QGIRP TFEELATRAH +E+S+ Sbjct: 42 LSLDCKDRLSKVSAVEMCIQGMHWGFLYIFQGIRPHTFEELATRAHDMELSI 93 >gb|EMJ02808.1| hypothetical protein PRUPE_ppa019755mg [Prunus persica] Length = 226 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEIS 165 LSLNCKD++SE S +EMCIQGMHW L YILQGI+P +FEEL TRAH IE+S Sbjct: 162 LSLNCKDRVSELSVVEMCIQGMHWGLLYILQGIKPHSFEELTTRAHDIELS 212 >gb|EMJ00639.1| hypothetical protein PRUPE_ppa026673mg [Prunus persica] Length = 468 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD++SE SA+EMCIQGMHW L YILQGI+P++FEEL TR H IE+S+ Sbjct: 234 LSLDCKDRVSELSAVEMCIQGMHWGLLYILQGIKPRSFEELTTRVHDIELSI 285 >gb|ADN33709.1| retrotransposon gag protein [Cucumis melo subsp. melo] Length = 576 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CKD+L+E SA+EMC QGMHW L YILQGI+P+TFEELATRAH +E S+ Sbjct: 251 LSLDCKDKLTELSAVEMCTQGMHWELLYILQGIKPRTFEELATRAHDMESSI 302 >emb|CAN74520.1| hypothetical protein VITISV_011170 [Vitis vinifera] Length = 408 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LS++CKD+LSE SA+EMCIQGMHWS YI QGIRP TFEEL TRAH I++S+ Sbjct: 326 LSIDCKDRLSEVSAMEMCIQGMHWSFLYIFQGIRPHTFEELTTRAHDIKLSI 377 >ref|XP_002314375.1| predicted protein [Populus trichocarpa] Length = 1335 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/51 (72%), Positives = 47/51 (92%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEIS 165 LSLNC+D+L++ SA++MCIQGMHW L YILQGI+PK+FEELATRAH +E+S Sbjct: 349 LSLNCRDRLTKTSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELS 399 >emb|CAN68664.1| hypothetical protein VITISV_004416 [Vitis vinifera] Length = 331 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CK+++ E S++EMCIQGMHW L YILQGI P+TFEELATRAH +EIS+ Sbjct: 187 LSLDCKNRVYEVSSVEMCIQGMHWGLLYILQGILPRTFEELATRAHDMEISI 238 >ref|XP_002333404.1| predicted protein [Populus trichocarpa] Length = 447 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/52 (69%), Positives = 47/52 (90%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSLN +D+L+E SA++MCIQGMHW L YILQGI+PK+FEELATRAH +++S+ Sbjct: 229 LSLNYRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMKLSI 280 >gb|EMJ14028.1| hypothetical protein PRUPE_ppa020726mg [Prunus persica] Length = 1078 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 LSL+CK +L E SA+EMCIQGMHW L YILQGI+P+TFEELAT H +E+S+ Sbjct: 354 LSLDCKYRLLELSAVEMCIQGMHWGLLYILQGIKPRTFEELATHVHDMELSI 405 >gb|ABM55241.1| retrotransposon protein [Beta vulgaris] Length = 302 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -3 Query: 317 LSLNCKDQLSEASAIEMCIQGMHWSLCYILQGIRPKTFEELATRAHAIEISL 162 L L CKD LS+ASA+E+C QG+HW L YILQGI+P TF+ELATRAH +E+++ Sbjct: 243 LCLQCKDHLSKASAVELCTQGIHWDLTYILQGIKPNTFQELATRAHEMEMTI 294