BLASTX nr result
ID: Rehmannia26_contig00027351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027351 (377 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicu... 89 5e-16 ref|XP_006342026.1| PREDICTED: auxin response factor 5-like [Sol... 88 1e-15 gb|EXB58397.1| Auxin response factor 5 [Morus notabilis] 87 2e-15 gb|EMJ26551.1| hypothetical protein PRUPE_ppa000946mg [Prunus pe... 81 1e-13 gb|AAO14628.1|AF467900_5 hypothetical transcription factor [Prun... 81 2e-13 gb|EOY14976.1| Transcriptional factor B3 family protein / auxin-... 80 4e-13 ref|XP_002300719.2| hypothetical protein POPTR_0002s02630g [Popu... 77 2e-12 ref|XP_006435146.1| hypothetical protein CICLE_v10000183mg [Citr... 76 4e-12 ref|XP_004499235.1| PREDICTED: auxin response factor 5-like [Cic... 76 4e-12 gb|AHC30881.1| auxin response factor [Dimocarpus longan] 76 5e-12 ref|XP_004147836.1| PREDICTED: auxin response factor 5-like [Cuc... 76 5e-12 ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isof... 76 5e-12 ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isof... 76 5e-12 emb|CBI19831.3| unnamed protein product [Vitis vinifera] 76 5e-12 ref|XP_006601343.1| PREDICTED: auxin response factor 5-like [Gly... 75 7e-12 ref|XP_003544394.2| PREDICTED: auxin response factor 5-like [Gly... 75 7e-12 gb|ESW32677.1| hypothetical protein PHAVU_001G008200g [Phaseolus... 75 7e-12 ref|XP_006473629.1| PREDICTED: auxin response factor 5-like isof... 75 9e-12 ref|XP_006473628.1| PREDICTED: auxin response factor 5-like isof... 75 9e-12 gb|EPS64438.1| hypothetical protein M569_10340, partial [Genlise... 75 1e-11 >ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicum] gi|300253180|gb|ADJ96592.1| auxin response factor 5 [Solanum lycopersicum] gi|310697420|gb|ADP06665.1| auxin response factor 5 [Solanum lycopersicum] Length = 930 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALE 240 DPWEEFVGCV+CIRILSP+EVQQMGEEGMQLLNSAG+QS+NGS E Sbjct: 882 DPWEEFVGCVRCIRILSPTEVQQMGEEGMQLLNSAGLQSINGSTSE 927 >ref|XP_006342026.1| PREDICTED: auxin response factor 5-like [Solanum tuberosum] Length = 929 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALE 240 DPWEEFVGCV+CIRILSP+EVQQMGEEGMQLLNSAG+Q +NGS E Sbjct: 881 DPWEEFVGCVRCIRILSPTEVQQMGEEGMQLLNSAGLQGINGSTSE 926 >gb|EXB58397.1| Auxin response factor 5 [Morus notabilis] Length = 940 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVG 234 DPWEEFVGCV+CIRILSP+EVQQM EEGM+LLNSA MQ +NGS LE G Sbjct: 891 DPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAAMQGINGSILEAG 938 >gb|EMJ26551.1| hypothetical protein PRUPE_ppa000946mg [Prunus persica] Length = 953 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALE 240 DPWEEFVGCV+CIRILSP+EVQQM EEGM+LLNSA MQ +NG+ E Sbjct: 903 DPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAAMQGINGTMSE 948 >gb|AAO14628.1|AF467900_5 hypothetical transcription factor [Prunus persica] Length = 954 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVG 234 DPWEEFVGCV+CIRILSP+EVQQM EEG++LLNSA MQ +NG+ E G Sbjct: 905 DPWEEFVGCVRCIRILSPTEVQQMSEEGIKLLNSAAMQGINGTMSEGG 952 >gb|EOY14976.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related [Theobroma cacao] Length = 951 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVGC 231 DPWEEFVGCV+CIRILSP+EVQQM EEGM+LLNSA +Q +NG+ E GC Sbjct: 902 DPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSATVQGINGTNSE-GC 949 >ref|XP_002300719.2| hypothetical protein POPTR_0002s02630g [Populus trichocarpa] gi|550344136|gb|EEE79992.2| hypothetical protein POPTR_0002s02630g [Populus trichocarpa] Length = 933 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVN 255 DPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNSA +Q +N Sbjct: 884 DPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSANIQGIN 924 >ref|XP_006435146.1| hypothetical protein CICLE_v10000183mg [Citrus clementina] gi|557537268|gb|ESR48386.1| hypothetical protein CICLE_v10000183mg [Citrus clementina] Length = 946 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVG 234 DPWEEFVGCV+CIRILSP EVQQM EEGM+LLNSA MQ ++ + E G Sbjct: 897 DPWEEFVGCVRCIRILSPQEVQQMSEEGMKLLNSAAMQGIDCTKPEGG 944 >ref|XP_004499235.1| PREDICTED: auxin response factor 5-like [Cicer arietinum] Length = 917 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVN 255 DPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +Q +N Sbjct: 876 DPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGIN 916 >gb|AHC30881.1| auxin response factor [Dimocarpus longan] Length = 942 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGS 249 DPWEEFVGCV+CIRILSP EVQQM EEGM+LLNSA MQ ++ S Sbjct: 893 DPWEEFVGCVRCIRILSPQEVQQMSEEGMKLLNSAAMQGIDCS 935 >ref|XP_004147836.1| PREDICTED: auxin response factor 5-like [Cucumis sativus] gi|449476870|ref|XP_004154860.1| PREDICTED: auxin response factor 5-like [Cucumis sativus] Length = 949 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVG 234 DPWEEFV CV+CIRILSPSEVQQM EEGM+LLNSA MQ +N E G Sbjct: 900 DPWEEFVSCVRCIRILSPSEVQQMSEEGMKLLNSAMMQGINCPMSEGG 947 >ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isoform 2 [Vitis vinifera] Length = 947 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGS 249 DPW+EFVGCV+CIRILSPSEVQQM EEGMQLLNS ++ +N S Sbjct: 902 DPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 944 >ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isoform 1 [Vitis vinifera] Length = 925 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGS 249 DPW+EFVGCV+CIRILSPSEVQQM EEGMQLLNS ++ +N S Sbjct: 880 DPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 922 >emb|CBI19831.3| unnamed protein product [Vitis vinifera] Length = 907 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGS 249 DPW+EFVGCV+CIRILSPSEVQQM EEGMQLLNS ++ +N S Sbjct: 862 DPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 904 >ref|XP_006601343.1| PREDICTED: auxin response factor 5-like [Glycine max] Length = 933 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVN 255 DPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +Q +N Sbjct: 892 DPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMN 932 >ref|XP_003544394.2| PREDICTED: auxin response factor 5-like [Glycine max] Length = 930 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVN 255 DPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +Q +N Sbjct: 889 DPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMN 929 >gb|ESW32677.1| hypothetical protein PHAVU_001G008200g [Phaseolus vulgaris] Length = 937 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVN 255 DPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +Q +N Sbjct: 896 DPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMN 936 >ref|XP_006473629.1| PREDICTED: auxin response factor 5-like isoform X2 [Citrus sinensis] Length = 944 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVG 234 DPWEEFVGCV+CIRILSP EV+QM EEGM+LLNSA MQ ++ + E G Sbjct: 895 DPWEEFVGCVRCIRILSPQEVEQMSEEGMKLLNSAAMQGIDCTKPEGG 942 >ref|XP_006473628.1| PREDICTED: auxin response factor 5-like isoform X1 [Citrus sinensis] Length = 946 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAGMQSVNGSALEVG 234 DPWEEFVGCV+CIRILSP EV+QM EEGM+LLNSA MQ ++ + E G Sbjct: 897 DPWEEFVGCVRCIRILSPQEVEQMSEEGMKLLNSAAMQGIDCTKPEGG 944 >gb|EPS64438.1| hypothetical protein M569_10340, partial [Genlisea aurea] Length = 720 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 377 DPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSAG 270 DPWEEFVGCV+CIRILSPSEV+QMGEEGMQLLNS G Sbjct: 681 DPWEEFVGCVRCIRILSPSEVRQMGEEGMQLLNSVG 716