BLASTX nr result
ID: Rehmannia26_contig00027261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027261 (513 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC11589.1| Putative zinc finger protein CONSTANS-LIKE 11 [Mo... 123 2e-26 ref|XP_006383971.1| hypothetical protein POPTR_0004s02600g [Popu... 123 2e-26 gb|EOY28480.1| B-box type zinc finger family protein, putative i... 123 3e-26 gb|EOY28479.1| B-box type zinc finger family protein, putative i... 123 3e-26 ref|XP_002524716.1| conserved hypothetical protein [Ricinus comm... 121 8e-26 ref|XP_006449180.1| hypothetical protein CICLE_v10016798mg [Citr... 120 1e-25 ref|XP_006449179.1| hypothetical protein CICLE_v10016798mg [Citr... 120 1e-25 ref|XP_006464656.1| PREDICTED: zinc finger protein hangover-like... 120 2e-25 ref|XP_006452028.1| hypothetical protein CICLE_v10009213mg [Citr... 120 2e-25 gb|ADL36671.1| COL domain class transcription factor [Malus dome... 120 2e-25 ref|XP_006401569.1| hypothetical protein EUTSA_v10014573mg [Eutr... 119 3e-25 ref|XP_004232775.1| PREDICTED: uncharacterized protein LOC101246... 119 4e-25 ref|XP_006467930.1| PREDICTED: structural maintenance of chromos... 119 5e-25 ref|XP_006467929.1| PREDICTED: structural maintenance of chromos... 119 5e-25 ref|XP_006467928.1| PREDICTED: structural maintenance of chromos... 119 5e-25 ref|XP_006413091.1| hypothetical protein EUTSA_v10026046mg [Eutr... 118 9e-25 gb|EXB44591.1| Putative zinc finger protein CONSTANS-LIKE 11 [Mo... 117 1e-24 ref|XP_006347164.1| PREDICTED: SAGA-associated factor 73-like [S... 117 1e-24 ref|XP_004154811.1| PREDICTED: uncharacterized protein LOC101228... 117 2e-24 ref|XP_004146838.1| PREDICTED: uncharacterized protein LOC101209... 117 2e-24 >gb|EXC11589.1| Putative zinc finger protein CONSTANS-LIKE 11 [Morus notabilis] Length = 205 Score = 123 bits (309), Expect = 2e-26 Identities = 52/68 (76%), Positives = 58/68 (85%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A+MYC SD+ASLCWDCD+RVH ANFLV+KH+RTLLC CQSPT W GSGPKL PT Sbjct: 6 LCDSQAKMYCESDRASLCWDCDARVHGANFLVAKHSRTLLCRVCQSPTPWNGSGPKLSPT 65 Query: 171 VSVCEACV 148 VSVCE+CV Sbjct: 66 VSVCESCV 73 >ref|XP_006383971.1| hypothetical protein POPTR_0004s02600g [Populus trichocarpa] gi|550340173|gb|ERP61768.1| hypothetical protein POPTR_0004s02600g [Populus trichocarpa] Length = 151 Score = 123 bits (309), Expect = 2e-26 Identities = 51/68 (75%), Positives = 60/68 (88%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC +A+MYC SDQASLCWDCD+ VH+ANFLV+KH+RTLLCH CQS T WTG+GPKLGPT Sbjct: 6 LCDSLAKMYCESDQASLCWDCDANVHSANFLVAKHSRTLLCHVCQSLTPWTGTGPKLGPT 65 Query: 171 VSVCEACV 148 +SVC+ CV Sbjct: 66 LSVCDNCV 73 >gb|EOY28480.1| B-box type zinc finger family protein, putative isoform 2 [Theobroma cacao] Length = 223 Score = 123 bits (308), Expect = 3e-26 Identities = 52/68 (76%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC +A+MYC SD A LCWDCDSRVH ANFLV+KH RTLLCH CQSPT W GSGPKLGPT Sbjct: 6 LCNSLAKMYCESDLAILCWDCDSRVHGANFLVAKHLRTLLCHLCQSPTPWNGSGPKLGPT 65 Query: 171 VSVCEACV 148 VS C+ CV Sbjct: 66 VSACDNCV 73 >gb|EOY28479.1| B-box type zinc finger family protein, putative isoform 1 [Theobroma cacao] Length = 269 Score = 123 bits (308), Expect = 3e-26 Identities = 52/68 (76%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC +A+MYC SD A LCWDCDSRVH ANFLV+KH RTLLCH CQSPT W GSGPKLGPT Sbjct: 51 LCNSLAKMYCESDLAILCWDCDSRVHGANFLVAKHLRTLLCHLCQSPTPWNGSGPKLGPT 110 Query: 171 VSVCEACV 148 VS C+ CV Sbjct: 111 VSACDNCV 118 >ref|XP_002524716.1| conserved hypothetical protein [Ricinus communis] gi|223536077|gb|EEF37735.1| conserved hypothetical protein [Ricinus communis] Length = 194 Score = 121 bits (304), Expect = 8e-26 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC +A+MYC SDQASLCWDCD+RVHAANFLV+KH+RTLLCH CQS T WT SGP+L PT Sbjct: 6 LCNSLAKMYCESDQASLCWDCDARVHAANFLVAKHSRTLLCHLCQSFTPWTASGPRLRPT 65 Query: 171 VSVCEACV 148 VS+C+ CV Sbjct: 66 VSICDNCV 73 >ref|XP_006449180.1| hypothetical protein CICLE_v10016798mg [Citrus clementina] gi|557551791|gb|ESR62420.1| hypothetical protein CICLE_v10016798mg [Citrus clementina] Length = 197 Score = 120 bits (302), Expect = 1e-25 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A+M+C SDQASLCWDCD++VH ANFLV+KH+RTLLCH CQS T W GSGPKLGPT Sbjct: 6 LCGSPAKMFCESDQASLCWDCDTKVHGANFLVAKHSRTLLCHVCQSLTPWNGSGPKLGPT 65 Query: 171 VSVCEACV 148 +SVC CV Sbjct: 66 ISVCNVCV 73 >ref|XP_006449179.1| hypothetical protein CICLE_v10016798mg [Citrus clementina] gi|557551790|gb|ESR62419.1| hypothetical protein CICLE_v10016798mg [Citrus clementina] Length = 196 Score = 120 bits (302), Expect = 1e-25 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A+M+C SDQASLCWDCD++VH ANFLV+KH+RTLLCH CQS T W GSGPKLGPT Sbjct: 6 LCGSPAKMFCESDQASLCWDCDTKVHGANFLVAKHSRTLLCHVCQSLTPWNGSGPKLGPT 65 Query: 171 VSVCEACV 148 +SVC CV Sbjct: 66 ISVCNVCV 73 >ref|XP_006464656.1| PREDICTED: zinc finger protein hangover-like [Citrus sinensis] Length = 264 Score = 120 bits (300), Expect = 2e-25 Identities = 52/68 (76%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC+ ARMYC SDQASLCWDCD +VH ANFLV+KH R LLCH CQS T W SGPKLGPT Sbjct: 6 LCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPT 65 Query: 171 VSVCEACV 148 VSVC+ACV Sbjct: 66 VSVCDACV 73 >ref|XP_006452028.1| hypothetical protein CICLE_v10009213mg [Citrus clementina] gi|557555254|gb|ESR65268.1| hypothetical protein CICLE_v10009213mg [Citrus clementina] Length = 264 Score = 120 bits (300), Expect = 2e-25 Identities = 52/68 (76%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC+ ARMYC SDQASLCWDCD +VH ANFLV+KH R LLCH CQS T W SGPKLGPT Sbjct: 6 LCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPT 65 Query: 171 VSVCEACV 148 VSVC+ACV Sbjct: 66 VSVCDACV 73 >gb|ADL36671.1| COL domain class transcription factor [Malus domestica] Length = 144 Score = 120 bits (300), Expect = 2e-25 Identities = 51/68 (75%), Positives = 58/68 (85%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A++YC+SDQASLCWDCD +VH ANFLV+KH+RTLLCH CQSPT W GSG KL PT Sbjct: 6 LCDSAAKVYCDSDQASLCWDCDVKVHGANFLVAKHSRTLLCHVCQSPTPWIGSGLKLCPT 65 Query: 171 VSVCEACV 148 VSVCE+CV Sbjct: 66 VSVCESCV 73 >ref|XP_006401569.1| hypothetical protein EUTSA_v10014573mg [Eutrema salsugineum] gi|557102659|gb|ESQ43022.1| hypothetical protein EUTSA_v10014573mg [Eutrema salsugineum] Length = 232 Score = 119 bits (299), Expect = 3e-25 Identities = 51/68 (75%), Positives = 57/68 (83%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC VARM+C SDQASLCWDCD +VH ANFLV+KHTR LLC ACQSPT W SG +LGPT Sbjct: 8 LCSGVARMFCESDQASLCWDCDGKVHGANFLVAKHTRCLLCSACQSPTPWKASGLRLGPT 67 Query: 171 VSVCEACV 148 VS+CE+CV Sbjct: 68 VSICESCV 75 >ref|XP_004232775.1| PREDICTED: uncharacterized protein LOC101246984 [Solanum lycopersicum] Length = 185 Score = 119 bits (298), Expect = 4e-25 Identities = 50/67 (74%), Positives = 58/67 (86%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC +AR+YC SDQASLCWDCD+RVH ANFLV+KH+R LLC++CQS T WTGSG KLGPT Sbjct: 6 LCSSIARVYCESDQASLCWDCDARVHTANFLVAKHSRILLCNSCQSLTPWTGSGSKLGPT 65 Query: 171 VSVCEAC 151 VSVC+ C Sbjct: 66 VSVCQKC 72 >ref|XP_006467930.1| PREDICTED: structural maintenance of chromosomes protein 4-like isoform X3 [Citrus sinensis] Length = 185 Score = 119 bits (297), Expect = 5e-25 Identities = 49/68 (72%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A+M+C SDQASLCWDCD++VH ANFLV+ H+RTLLCH CQS T W GSGPKLGPT Sbjct: 6 LCGSPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPT 65 Query: 171 VSVCEACV 148 +SVC CV Sbjct: 66 ISVCNVCV 73 >ref|XP_006467929.1| PREDICTED: structural maintenance of chromosomes protein 4-like isoform X2 [Citrus sinensis] Length = 197 Score = 119 bits (297), Expect = 5e-25 Identities = 49/68 (72%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A+M+C SDQASLCWDCD++VH ANFLV+ H+RTLLCH CQS T W GSGPKLGPT Sbjct: 6 LCGSPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPT 65 Query: 171 VSVCEACV 148 +SVC CV Sbjct: 66 ISVCNVCV 73 >ref|XP_006467928.1| PREDICTED: structural maintenance of chromosomes protein 4-like isoform X1 [Citrus sinensis] Length = 198 Score = 119 bits (297), Expect = 5e-25 Identities = 49/68 (72%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC A+M+C SDQASLCWDCD++VH ANFLV+ H+RTLLCH CQS T W GSGPKLGPT Sbjct: 6 LCGSPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPT 65 Query: 171 VSVCEACV 148 +SVC CV Sbjct: 66 ISVCNVCV 73 >ref|XP_006413091.1| hypothetical protein EUTSA_v10026046mg [Eutrema salsugineum] gi|557114261|gb|ESQ54544.1| hypothetical protein EUTSA_v10026046mg [Eutrema salsugineum] Length = 256 Score = 118 bits (295), Expect = 9e-25 Identities = 51/68 (75%), Positives = 56/68 (82%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC VARMYC SDQASLCWDCD +VH ANFLV+KHTR LLC ACQSPT W SG +LGPT Sbjct: 7 LCDGVARMYCESDQASLCWDCDGKVHGANFLVAKHTRCLLCSACQSPTPWKASGLRLGPT 66 Query: 171 VSVCEACV 148 SVC++CV Sbjct: 67 FSVCDSCV 74 >gb|EXB44591.1| Putative zinc finger protein CONSTANS-LIKE 11 [Morus notabilis] Length = 250 Score = 117 bits (294), Expect = 1e-24 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC ARM+C SDQASLCWDCD +VH ANFLV+KHTR+LLCH C SPT W SGPKL PT Sbjct: 6 LCGLRARMHCESDQASLCWDCDEKVHGANFLVAKHTRSLLCHVCHSPTPWKASGPKLTPT 65 Query: 171 VSVCEACV 148 VSVCE CV Sbjct: 66 VSVCENCV 73 >ref|XP_006347164.1| PREDICTED: SAGA-associated factor 73-like [Solanum tuberosum] Length = 190 Score = 117 bits (294), Expect = 1e-24 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC +AR+YC SDQASLCWDCD+RVH ANFLV+KH+R LLC++CQS T W+GSG KLGPT Sbjct: 6 LCSSIARVYCESDQASLCWDCDARVHTANFLVAKHSRILLCNSCQSLTPWSGSGSKLGPT 65 Query: 171 VSVCEAC 151 VSVC+ C Sbjct: 66 VSVCQKC 72 >ref|XP_004154811.1| PREDICTED: uncharacterized protein LOC101228838 [Cucumis sativus] Length = 269 Score = 117 bits (293), Expect = 2e-24 Identities = 50/68 (73%), Positives = 55/68 (80%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC ARM+C SDQA+LCWDCD +VH ANFLV+KH+RTLLCH CQSPT W SG KL PT Sbjct: 6 LCGHQARMFCESDQANLCWDCDEKVHCANFLVAKHSRTLLCHVCQSPTPWAASGRKLTPT 65 Query: 171 VSVCEACV 148 VSVCE CV Sbjct: 66 VSVCEGCV 73 >ref|XP_004146838.1| PREDICTED: uncharacterized protein LOC101209141 [Cucumis sativus] Length = 274 Score = 117 bits (293), Expect = 2e-24 Identities = 50/68 (73%), Positives = 55/68 (80%) Frame = -1 Query: 351 LCKKVARMYCNSDQASLCWDCDSRVHAANFLVSKHTRTLLCHACQSPTSWTGSGPKLGPT 172 LC ARM+C SDQA+LCWDCD +VH ANFLV+KH+RTLLCH CQSPT W SG KL PT Sbjct: 6 LCGHQARMFCESDQANLCWDCDEKVHCANFLVAKHSRTLLCHVCQSPTPWAASGRKLTPT 65 Query: 171 VSVCEACV 148 VSVCE CV Sbjct: 66 VSVCEGCV 73