BLASTX nr result
ID: Rehmannia26_contig00027212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00027212 (543 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC16164.1| UDP-glycosyltransferase 86A1 [Morus notabilis] 56 6e-06 >gb|EXC16164.1| UDP-glycosyltransferase 86A1 [Morus notabilis] Length = 489 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 453 KPHAIMLAFPFQGHITPFLNLAIKLASKGF 542 KPHAIM+ F FQGHITPF+NLAIKLAS+GF Sbjct: 8 KPHAIMIPFYFQGHITPFVNLAIKLASEGF 37