BLASTX nr result
ID: Rehmannia26_contig00026417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00026417 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006659788.1| PREDICTED: lysine histidine transporter 1-li... 102 4e-20 ref|XP_004972967.1| PREDICTED: lysine histidine transporter 1-li... 102 5e-20 ref|NP_001060901.1| Os08g0127100 [Oryza sativa Japonica Group] g... 101 9e-20 ref|NP_001147827.1| LHT1 [Zea mays] gi|195613982|gb|ACG28821.1| ... 101 9e-20 emb|CAD89802.1| histidine amino acid transporter [Oryza sativa I... 101 9e-20 ref|XP_004972971.1| PREDICTED: lysine histidine transporter 1-li... 101 1e-19 ref|XP_004972969.1| PREDICTED: lysine histidine transporter 1-li... 101 1e-19 ref|XP_006338671.1| PREDICTED: lysine histidine transporter 1-li... 100 2e-19 ref|XP_004231799.1| PREDICTED: lysine histidine transporter 1-li... 100 2e-19 ref|XP_004973098.1| PREDICTED: lysine histidine transporter 1-li... 100 3e-19 ref|XP_006395461.1| hypothetical protein EUTSA_v10004214mg [Eutr... 99 5e-19 ref|XP_004972964.1| PREDICTED: lysine histidine transporter 1-li... 99 5e-19 ref|XP_004236736.1| PREDICTED: lysine histidine transporter 1-li... 99 5e-19 gb|EMT11525.1| hypothetical protein F775_27209 [Aegilops tauschii] 99 6e-19 emb|CAC12825.1| amino acid permease [Nicotiana tabacum] 99 6e-19 ref|XP_003597755.1| Lysine/histidine transporter [Medicago trunc... 99 6e-19 ref|XP_002443797.1| hypothetical protein SORBIDRAFT_07g002250 [S... 99 6e-19 gb|AGN03890.1| lysine histidine transporter [Panax ginseng] 99 8e-19 ref|XP_006292474.1| hypothetical protein CARUB_v10018703mg [Caps... 99 8e-19 gb|AFW74427.1| hypothetical protein ZEAMMB73_900262 [Zea mays] 99 8e-19 >ref|XP_006659788.1| PREDICTED: lysine histidine transporter 1-like [Oryza brachyantha] Length = 262 Score = 102 bits (255), Expect = 4e-20 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRRFSLSWFTNW+CII GVLL V+ PIGGLR II+ AKTYKFY Sbjct: 208 LPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMVLSPIGGLRQIIMDAKTYKFY 261 >ref|XP_004972967.1| PREDICTED: lysine histidine transporter 1-like [Setaria italica] Length = 451 Score = 102 bits (254), Expect = 5e-20 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPC++WLAIYKPRRFSLSWFTNW+CI+ GVLL V+ PIGGLR IIL AKTYKFY Sbjct: 397 LPCVMWLAIYKPRRFSLSWFTNWICIVLGVLLMVLAPIGGLRNIILNAKTYKFY 450 >ref|NP_001060901.1| Os08g0127100 [Oryza sativa Japonica Group] gi|42407710|dbj|BAD08858.1| putative histidine amino acid transporter [Oryza sativa Japonica Group] gi|113622870|dbj|BAF22815.1| Os08g0127100 [Oryza sativa Japonica Group] gi|215694479|dbj|BAG89420.1| unnamed protein product [Oryza sativa Japonica Group] gi|215716979|dbj|BAG95342.1| unnamed protein product [Oryza sativa Japonica Group] gi|218200418|gb|EEC82845.1| hypothetical protein OsI_27668 [Oryza sativa Indica Group] gi|222639848|gb|EEE67980.1| hypothetical protein OsJ_25900 [Oryza sativa Japonica Group] Length = 447 Score = 101 bits (252), Expect = 9e-20 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRRFSLSWFTNW+CII GV+L ++ PIGGLR II+ AKTYKFY Sbjct: 393 LPCIMWLAIYKPRRFSLSWFTNWICIILGVMLMILSPIGGLRQIIIDAKTYKFY 446 >ref|NP_001147827.1| LHT1 [Zea mays] gi|195613982|gb|ACG28821.1| LHT1 [Zea mays] gi|413941773|gb|AFW74422.1| LHT1 [Zea mays] Length = 472 Score = 101 bits (252), Expect = 9e-20 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKP+RFSLSWFTNW+CII GVLL V+ PIGGLR II+ AKTYKFY Sbjct: 418 LPCIMWLAIYKPKRFSLSWFTNWICIILGVLLMVLAPIGGLRQIIISAKTYKFY 471 >emb|CAD89802.1| histidine amino acid transporter [Oryza sativa Indica Group] Length = 441 Score = 101 bits (252), Expect = 9e-20 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRRFSLSWFTNW+CII GV+L ++ PIGGLR II+ AKTYKFY Sbjct: 387 LPCIMWLAIYKPRRFSLSWFTNWICIILGVMLMILSPIGGLRQIIIDAKTYKFY 440 >ref|XP_004972971.1| PREDICTED: lysine histidine transporter 1-like isoform X3 [Setaria italica] Length = 446 Score = 101 bits (251), Expect = 1e-19 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRRFSLSWFTNW+CII GVLL ++ PIGGLR II+ +KTYKFY Sbjct: 392 LPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMILSPIGGLRQIIMDSKTYKFY 445 >ref|XP_004972969.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Setaria italica] Length = 492 Score = 101 bits (251), Expect = 1e-19 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRRFSLSWFTNW+CII GVLL ++ PIGGLR II+ +KTYKFY Sbjct: 438 LPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMILSPIGGLRQIIMDSKTYKFY 491 >ref|XP_006338671.1| PREDICTED: lysine histidine transporter 1-like [Solanum tuberosum] Length = 449 Score = 100 bits (249), Expect = 2e-19 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRR+SLSW NW+CIIFGVLL V+ PIGGLR II+QAKTYKFY Sbjct: 395 LPCIMWLAIYKPRRWSLSWIANWICIIFGVLLMVLAPIGGLRSIIVQAKTYKFY 448 >ref|XP_004231799.1| PREDICTED: lysine histidine transporter 1-like [Solanum lycopersicum] Length = 449 Score = 100 bits (249), Expect = 2e-19 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRR+SLSW NW+CIIFGVLL V+ PIGGLR II+QAKTYKFY Sbjct: 395 LPCIMWLAIYKPRRWSLSWLANWICIIFGVLLMVLAPIGGLRSIIVQAKTYKFY 448 >ref|XP_004973098.1| PREDICTED: lysine histidine transporter 1-like [Setaria italica] Length = 446 Score = 99.8 bits (247), Expect = 3e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLA+YKP+RF LSWFTNW+CI+ GVLL V+ PIGGLR IIL AKTYKFY Sbjct: 392 LPCIMWLAVYKPKRFGLSWFTNWICIVIGVLLLVLSPIGGLRQIILTAKTYKFY 445 >ref|XP_006395461.1| hypothetical protein EUTSA_v10004214mg [Eutrema salsugineum] gi|557092100|gb|ESQ32747.1| hypothetical protein EUTSA_v10004214mg [Eutrema salsugineum] Length = 448 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/93 (51%), Positives = 61/93 (65%), Gaps = 3/93 (3%) Frame = -3 Query: 510 YFVSRYYNLACIY-SASFRKYNVFLVLVEGIIIVYLQ--LPCIIWLAIYKPRRFSLSWFT 340 +FV +Y A ++ +F + L G LPC+IWLAIYKPRR+SLSW+ Sbjct: 355 FFVRNFYVAATMFVGMTFPFFGGLLAFFGGFAFAPTTYFLPCVIWLAIYKPRRYSLSWWA 414 Query: 339 NWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 NW+CI+FGV L V+ PIGGLR II+QAK YKFY Sbjct: 415 NWICIVFGVCLMVLSPIGGLRTIIIQAKDYKFY 447 >ref|XP_004972964.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Setaria italica] Length = 462 Score = 99.4 bits (246), Expect = 5e-19 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WL +YKP+RFSLSWFTNW+CI+ GVLL V+ PIGGLR IIL+A+TYKFY Sbjct: 408 LPCIMWLTVYKPKRFSLSWFTNWICIVLGVLLMVLSPIGGLRQIILKARTYKFY 461 >ref|XP_004236736.1| PREDICTED: lysine histidine transporter 1-like [Solanum lycopersicum] Length = 439 Score = 99.4 bits (246), Expect = 5e-19 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRRFSLSW+TNW+CI+ GVLL V+ PIG LR +ILQAKTYKFY Sbjct: 385 LPCIMWLAIYKPRRFSLSWWTNWICILIGVLLMVLAPIGALRHLILQAKTYKFY 438 >gb|EMT11525.1| hypothetical protein F775_27209 [Aegilops tauschii] Length = 447 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKP+RFSLSWFTNWVCI+ GV L ++ PIGGLR IIL +KTYKFY Sbjct: 393 LPCIMWLAIYKPKRFSLSWFTNWVCIVLGVCLMILSPIGGLRQIILDSKTYKFY 446 >emb|CAC12825.1| amino acid permease [Nicotiana tabacum] Length = 80 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKPRR+SLSW NW+CIIFGVLL V+ PIGGLR II+QA+TYKFY Sbjct: 26 LPCIMWLAIYKPRRWSLSWIANWICIIFGVLLMVLAPIGGLRSIIVQAQTYKFY 79 >ref|XP_003597755.1| Lysine/histidine transporter [Medicago truncatula] gi|355486803|gb|AES68006.1| Lysine/histidine transporter [Medicago truncatula] Length = 487 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKP+RFSLSWFTNW+CII G+LL ++ PIGGLRLIIL AK+Y FY Sbjct: 433 LPCIMWLAIYKPKRFSLSWFTNWICIILGLLLMILSPIGGLRLIILNAKSYGFY 486 >ref|XP_002443797.1| hypothetical protein SORBIDRAFT_07g002250 [Sorghum bicolor] gi|241940147|gb|EES13292.1| hypothetical protein SORBIDRAFT_07g002250 [Sorghum bicolor] Length = 460 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WLAIYKP+RFSLSWFTNW+CII GVLL V+ PIGGLR II+ AKTY FY Sbjct: 406 LPCIMWLAIYKPKRFSLSWFTNWICIILGVLLMVLAPIGGLRNIIISAKTYHFY 459 >gb|AGN03890.1| lysine histidine transporter [Panax ginseng] Length = 449 Score = 98.6 bits (244), Expect = 8e-19 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPC++WLAIYKPRR+SLSWFTNW+CI FGV L ++ PIGGLR II+QAKTY+F+ Sbjct: 395 LPCVMWLAIYKPRRYSLSWFTNWICIFFGVCLMILSPIGGLRQIIIQAKTYEFF 448 >ref|XP_006292474.1| hypothetical protein CARUB_v10018703mg [Capsella rubella] gi|482561181|gb|EOA25372.1| hypothetical protein CARUB_v10018703mg [Capsella rubella] Length = 433 Score = 98.6 bits (244), Expect = 8e-19 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPC+IWL IYKPRR+SLSW+TNW+CI+FG+ L V+ PIGGLR II+QAK YKFY Sbjct: 379 LPCVIWLKIYKPRRYSLSWWTNWICIVFGIFLMVLSPIGGLRTIIIQAKDYKFY 432 >gb|AFW74427.1| hypothetical protein ZEAMMB73_900262 [Zea mays] Length = 493 Score = 98.6 bits (244), Expect = 8e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 402 LPCIIWLAIYKPRRFSLSWFTNWVCIIFGVLLTVVGPIGGLRLIILQAKTYKFY 241 LPCI+WL IYKPRRFSLSWFTNW+CI+ GVLL V+ PIGGLR +IL+ KTYKFY Sbjct: 431 LPCIMWLIIYKPRRFSLSWFTNWICIVIGVLLMVLSPIGGLRQMILKIKTYKFY 484