BLASTX nr result
ID: Rehmannia26_contig00026207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00026207 (467 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73312.1| hypothetical protein VITISV_012096 [Vitis vinifera] 57 3e-06 >emb|CAN73312.1| hypothetical protein VITISV_012096 [Vitis vinifera] Length = 1817 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -1 Query: 464 SSPGQNPAKPERPPLTKKSKTTASGSDDSQP-PHFPGPLFPAVRR 333 S+P NP K ERPP+ KKS+T SDD P PHFPGPLFPAVRR Sbjct: 17 SNPKPNPNKYERPPVLKKSRTI---SDDVVPAPHFPGPLFPAVRR 58