BLASTX nr result
ID: Rehmannia26_contig00026096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00026096 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238407.1| PREDICTED: uncharacterized protein LOC101252... 56 4e-06 gb|EXB88235.1| hypothetical protein L484_011665 [Morus notabilis] 55 1e-05 >ref|XP_004238407.1| PREDICTED: uncharacterized protein LOC101252388 [Solanum lycopersicum] Length = 111 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 5 LTARLNHIKRSLLAEADLEPTGAFAARLRVLFGDES 112 L R+NHIK+SLLAEA EPTGAFA+RLR LFGDES Sbjct: 76 LVHRMNHIKQSLLAEAASEPTGAFASRLRRLFGDES 111 >gb|EXB88235.1| hypothetical protein L484_011665 [Morus notabilis] Length = 106 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 5 LTARLNHIKRSLLAEADLEPTGAFAARLRVLFGDES 112 LT R+ +IKR+LL EA LEPTGAFA+RLR+LFGDE+ Sbjct: 71 LTERMKNIKRALLHEASLEPTGAFASRLRLLFGDEN 106