BLASTX nr result
ID: Rehmannia26_contig00026014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00026014 (641 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445388.1| hypothetical protein CICLE_v10021338mg [Citr... 58 2e-06 ref|XP_006445387.1| hypothetical protein CICLE_v10021338mg [Citr... 56 8e-06 >ref|XP_006445388.1| hypothetical protein CICLE_v10021338mg [Citrus clementina] gi|568819838|ref|XP_006464451.1| PREDICTED: uncharacterized protein LOC102609123 isoform X1 [Citrus sinensis] gi|557547650|gb|ESR58628.1| hypothetical protein CICLE_v10021338mg [Citrus clementina] Length = 302 Score = 58.2 bits (139), Expect = 2e-06 Identities = 37/113 (32%), Positives = 52/113 (46%) Frame = -2 Query: 625 KQPKMTTWKSGYGKEKQEEKDIPKLPDFSLELKVDEISEDLFAVTGKMPSTKIKNMEKNV 446 K P+ +EK++EK+ + FS+ LK +EI +D FA+TG PS + K KNV Sbjct: 211 KPPEKKDTDKDKEREKEKEKEKKEKMKFSISLKKEEIEDDFFAMTGAKPSRRPKKRAKNV 270 Query: 445 LKQIDVVNNKLI*STVSVCCLILKFLQLIFPGGYLQMIMADRYKVPRNNRKAK 287 KQ+D V FPG +L I + YKV +K K Sbjct: 271 QKQLDYV----------------------FPGLWLASITPESYKVNNGTKKVK 301 >ref|XP_006445387.1| hypothetical protein CICLE_v10021338mg [Citrus clementina] gi|568819841|ref|XP_006464452.1| PREDICTED: uncharacterized protein LOC102609123 isoform X2 [Citrus sinensis] gi|557547649|gb|ESR58627.1| hypothetical protein CICLE_v10021338mg [Citrus clementina] Length = 300 Score = 56.2 bits (134), Expect = 8e-06 Identities = 36/111 (32%), Positives = 51/111 (45%) Frame = -2 Query: 625 KQPKMTTWKSGYGKEKQEEKDIPKLPDFSLELKVDEISEDLFAVTGKMPSTKIKNMEKNV 446 K P+ +EK++EK+ + FS+ LK +EI +D FA+TG PS + K KNV Sbjct: 211 KPPEKKDTDKDKEREKEKEKEKKEKMKFSISLKKEEIEDDFFAMTGAKPSRRPKKRAKNV 270 Query: 445 LKQIDVVNNKLI*STVSVCCLILKFLQLIFPGGYLQMIMADRYKVPRNNRK 293 KQ+D V FPG +L I + YKV +K Sbjct: 271 QKQLDYV----------------------FPGLWLASITPESYKVNNGTKK 299