BLASTX nr result
ID: Rehmannia26_contig00023913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00023913 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245597.1| PREDICTED: signal peptide peptidase-like 2-l... 116 3e-24 ref|XP_006343972.1| PREDICTED: signal peptide peptidase-like 2-l... 110 3e-22 gb|AFK45400.1| unknown [Lotus japonicus] 108 6e-22 ref|XP_006476550.1| PREDICTED: signal peptide peptidase-like 2-l... 107 1e-21 ref|XP_006439532.1| hypothetical protein CICLE_v10019598mg [Citr... 107 1e-21 gb|EOX95946.1| Signal peptide peptidase-like 4 [Theobroma cacao] 107 1e-21 ref|XP_004298804.1| PREDICTED: signal peptide peptidase-like 2-l... 107 1e-21 ref|XP_004298803.1| PREDICTED: signal peptide peptidase-like 2-l... 107 1e-21 gb|EOY24767.1| Signal peptide peptidase-like 2 isoform 3 [Theobr... 106 3e-21 gb|EOY24765.1| Signal peptide peptidase-like 2 isoform 1 [Theobr... 106 3e-21 ref|XP_004306779.1| PREDICTED: signal peptide peptidase-like 4-l... 106 3e-21 ref|XP_006445025.1| hypothetical protein CICLE_v10019661mg [Citr... 105 8e-21 ref|XP_002299526.2| protease-associated domain-containing family... 104 1e-20 ref|XP_002509814.1| Minor histocompatibility antigen H13, putati... 104 1e-20 ref|XP_002274996.2| PREDICTED: signal peptide peptidase-like 2B-... 104 1e-20 gb|EXB37340.1| Signal peptide peptidase-like 2B [Morus notabilis] 103 2e-20 gb|EMJ11072.1| hypothetical protein PRUPE_ppa003858mg [Prunus pe... 103 2e-20 gb|EXB30879.1| Signal peptide peptidase-like 2B [Morus notabilis] 103 2e-20 ref|XP_002303595.2| protease-associated domain-containing family... 103 2e-20 ref|XP_003627574.1| Signal peptide peptidase-like 2B [Medicago t... 103 2e-20 >ref|XP_004245597.1| PREDICTED: signal peptide peptidase-like 2-like [Solanum lycopersicum] Length = 544 Score = 116 bits (290), Expect = 3e-24 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQES 176 ALNLMDGHGQPALLYIVPFTLGTFL LGRKRGDLKILWT+GEPERVCPHVRLES +ES Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLMLGRKRGDLKILWTKGEPERVCPHVRLESIEES 540 >ref|XP_006343972.1| PREDICTED: signal peptide peptidase-like 2-like [Solanum tuberosum] Length = 544 Score = 110 bits (274), Expect = 3e-22 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQES 176 ALNLMDGHGQPALLYIVPFTLGTFL LGRKRGDLKILWT+GEPERVCPHV L S +ES Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLMLGRKRGDLKILWTKGEPERVCPHVCLISIEES 540 >gb|AFK45400.1| unknown [Lotus japonicus] Length = 182 Score = 108 bits (271), Expect = 6e-22 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTF+ALG+KRGDL++LWTRGEPER CPH+RL+ ++E Sbjct: 123 ALNLMDGHGQPALLYIVPFTLGTFMALGKKRGDLRLLWTRGEPERPCPHIRLQHSEE 179 >ref|XP_006476550.1| PREDICTED: signal peptide peptidase-like 2-like [Citrus sinensis] Length = 544 Score = 107 bits (268), Expect = 1e-21 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFLALG+KRGDL++LWTRGEPER CPHV L+ + E Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLALGKKRGDLRVLWTRGEPERPCPHVHLQHSHE 539 >ref|XP_006439532.1| hypothetical protein CICLE_v10019598mg [Citrus clementina] gi|557541794|gb|ESR52772.1| hypothetical protein CICLE_v10019598mg [Citrus clementina] Length = 544 Score = 107 bits (268), Expect = 1e-21 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFLALG+KRGDL++LWTRGEPER CPHV L+ + E Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLALGKKRGDLRVLWTRGEPERPCPHVHLQHSHE 539 >gb|EOX95946.1| Signal peptide peptidase-like 4 [Theobroma cacao] Length = 538 Score = 107 bits (268), Expect = 1e-21 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALN+MDGHGQPALLYIVPFTLGTF+ LG+KRGDLKILWTRGEPER CPHV+L+ QE Sbjct: 481 ALNMMDGHGQPALLYIVPFTLGTFITLGKKRGDLKILWTRGEPERPCPHVQLQPLQE 537 >ref|XP_004298804.1| PREDICTED: signal peptide peptidase-like 2-like isoform 2 [Fragaria vesca subsp. vesca] Length = 522 Score = 107 bits (268), Expect = 1e-21 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGT L LG+KRGDL ILW+RGEPER+CPHVRLE +QE Sbjct: 462 ALNLMDGHGQPALLYIVPFTLGTLLTLGKKRGDLPILWSRGEPERLCPHVRLEHSQE 518 >ref|XP_004298803.1| PREDICTED: signal peptide peptidase-like 2-like isoform 1 [Fragaria vesca subsp. vesca] Length = 543 Score = 107 bits (268), Expect = 1e-21 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGT L LG+KRGDL ILW+RGEPER+CPHVRLE +QE Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTLLTLGKKRGDLPILWSRGEPERLCPHVRLEHSQE 539 >gb|EOY24767.1| Signal peptide peptidase-like 2 isoform 3 [Theobroma cacao] Length = 504 Score = 106 bits (265), Expect = 3e-21 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLE 161 ALNLMDGHGQPALLYIVPFTLGTFL LGRKRGDL++LWTRGEPER CPH++LE Sbjct: 441 ALNLMDGHGQPALLYIVPFTLGTFLTLGRKRGDLRVLWTRGEPERPCPHIQLE 493 >gb|EOY24765.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao] gi|508777510|gb|EOY24766.1| Signal peptide peptidase-like 2 isoform 1 [Theobroma cacao] Length = 546 Score = 106 bits (265), Expect = 3e-21 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLE 161 ALNLMDGHGQPALLYIVPFTLGTFL LGRKRGDL++LWTRGEPER CPH++LE Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLTLGRKRGDLRVLWTRGEPERPCPHIQLE 535 >ref|XP_004306779.1| PREDICTED: signal peptide peptidase-like 4-like [Fragaria vesca subsp. vesca] Length = 540 Score = 106 bits (265), Expect = 3e-21 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLEST 167 ALNLMDGHGQPALLYIVPFTLGTFL LG+ RGDLK+LWTRGEPER CPHVRL+S+ Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLTLGQMRGDLKVLWTRGEPERPCPHVRLQSS 537 >ref|XP_006445025.1| hypothetical protein CICLE_v10019661mg [Citrus clementina] gi|568876073|ref|XP_006491110.1| PREDICTED: signal peptide peptidase-like 4-like [Citrus sinensis] gi|557547287|gb|ESR58265.1| hypothetical protein CICLE_v10019661mg [Citrus clementina] Length = 535 Score = 105 bits (261), Expect = 8e-21 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLEST 167 ALNLMDGHGQPALLYIVPFTLGTFL LG+KRG+LK LWTRGEPER CPH++L+S+ Sbjct: 481 ALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGELKTLWTRGEPERACPHIQLQSS 535 >ref|XP_002299526.2| protease-associated domain-containing family protein [Populus trichocarpa] gi|550346892|gb|EEE84331.2| protease-associated domain-containing family protein [Populus trichocarpa] Length = 541 Score = 104 bits (260), Expect = 1e-20 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFL LG+KRGDL++LWT+GEP+R CPHV L+ +QE Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLRVLWTQGEPQRPCPHVLLQRSQE 539 >ref|XP_002509814.1| Minor histocompatibility antigen H13, putative [Ricinus communis] gi|223549713|gb|EEF51201.1| Minor histocompatibility antigen H13, putative [Ricinus communis] Length = 542 Score = 104 bits (260), Expect = 1e-20 Identities = 47/57 (82%), Positives = 50/57 (87%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFL LG+KRGDL +LWTRGEPER CPH+ LE E Sbjct: 481 ALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLYVLWTRGEPERPCPHIHLEHCHE 537 >ref|XP_002274996.2| PREDICTED: signal peptide peptidase-like 2B-like [Vitis vinifera] gi|297742511|emb|CBI34660.3| unnamed protein product [Vitis vinifera] Length = 548 Score = 104 bits (259), Expect = 1e-20 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFL LGRKRGDLK LWTRG PER CPHV+ E +QE Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLTLGRKRGDLKNLWTRGVPERPCPHVQHEHSQE 539 >gb|EXB37340.1| Signal peptide peptidase-like 2B [Morus notabilis] Length = 543 Score = 103 bits (258), Expect = 2e-20 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFL LG+KRGDL LW++GEPER CPHVRL+ QE Sbjct: 482 ALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLGTLWSKGEPERPCPHVRLQECQE 538 >gb|EMJ11072.1| hypothetical protein PRUPE_ppa003858mg [Prunus persica] Length = 544 Score = 103 bits (258), Expect = 2e-20 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFL LG+KRGDL+ILW RGEPER C H+ LE +QE Sbjct: 483 ALNLMDGHGQPALLYIVPFTLGTFLTLGKKRGDLQILWCRGEPERPCSHIELEQSQE 539 >gb|EXB30879.1| Signal peptide peptidase-like 2B [Morus notabilis] Length = 476 Score = 103 bits (257), Expect = 2e-20 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLG FL LG+KRGDLKILW RGEPER CPHV++E +E Sbjct: 415 ALNLMDGHGQPALLYIVPFTLGPFLTLGKKRGDLKILWIRGEPERPCPHVKVEPYEE 471 >ref|XP_002303595.2| protease-associated domain-containing family protein [Populus trichocarpa] gi|550343057|gb|EEE78574.2| protease-associated domain-containing family protein [Populus trichocarpa] Length = 539 Score = 103 bits (257), Expect = 2e-20 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVRLESTQE 173 ALNLMDGHGQPALLYIVPFTLGTFLALG+KRGDL++LWT+GEPE C HVRL+ ++E Sbjct: 481 ALNLMDGHGQPALLYIVPFTLGTFLALGKKRGDLRVLWTQGEPETPCSHVRLQHSEE 537 >ref|XP_003627574.1| Signal peptide peptidase-like 2B [Medicago truncatula] gi|355521596|gb|AET02050.1| Signal peptide peptidase-like 2B [Medicago truncatula] Length = 573 Score = 103 bits (257), Expect = 2e-20 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +3 Query: 3 ALNLMDGHGQPALLYIVPFTLGTFLALGRKRGDLKILWTRGEPERVCPHVR 155 ALNLMDGHGQPALLYIVPFTLGTFL+LG+KRGDLKILWTRGEPER CPH++ Sbjct: 514 ALNLMDGHGQPALLYIVPFTLGTFLSLGKKRGDLKILWTRGEPERHCPHIQ 564