BLASTX nr result
ID: Rehmannia26_contig00022156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022156 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putati... 77 2e-12 ref|XP_006447130.1| hypothetical protein CICLE_v10015345mg [Citr... 76 4e-12 ref|XP_006338677.1| PREDICTED: COP9 signalosome complex subunit ... 75 9e-12 ref|XP_002300091.1| hypothetical protein POPTR_0001s34180g [Popu... 75 1e-11 ref|XP_004231795.1| PREDICTED: COP9 signalosome complex subunit ... 74 2e-11 ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit ... 73 4e-11 ref|XP_004303998.1| PREDICTED: COP9 signalosome complex subunit ... 69 5e-10 gb|EXC31360.1| COP9 signalosome complex subunit 3 [Morus notabilis] 68 1e-09 gb|EOY02711.1| Proteasome component domain protein [Theobroma ca... 68 1e-09 gb|EMJ16636.1| hypothetical protein PRUPE_ppa006197mg [Prunus pe... 67 2e-09 ref|XP_004159785.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalo... 66 5e-09 ref|XP_004138469.1| PREDICTED: COP9 signalosome complex subunit ... 66 5e-09 ref|NP_568296.1| COP9 signalosome complex subunit 3 [Arabidopsis... 64 2e-08 ref|XP_006287815.1| hypothetical protein CARUB_v10001029mg [Caps... 64 2e-08 gb|AAL31917.1|AF419585_1 AT5g14250/F18O22_40 [Arabidopsis thalia... 64 2e-08 ref|XP_002871609.1| hypothetical protein ARALYDRAFT_488259 [Arab... 64 2e-08 emb|CAB87764.1| putative protein [Arabidopsis thaliana] 64 2e-08 ref|NP_001169045.1| uncharacterized protein LOC100382885 [Zea ma... 62 8e-08 gb|ESW23538.1| hypothetical protein PHAVU_004G055700g [Phaseolus... 61 1e-07 ref|XP_006848613.1| hypothetical protein AMTR_s00171p00017320 [A... 60 2e-07 >ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] gi|223549455|gb|EEF50943.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] Length = 427 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LSKKLTAM+ELMSCDP YL K GR+RQRFD +DFDTVP KFNI Sbjct: 385 LSKKLTAMDELMSCDPLYLAKAGRERQRFDFDDFDTVPQKFNI 427 >ref|XP_006447130.1| hypothetical protein CICLE_v10015345mg [Citrus clementina] gi|568831517|ref|XP_006470009.1| PREDICTED: COP9 signalosome complex subunit 3-like [Citrus sinensis] gi|557549741|gb|ESR60370.1| hypothetical protein CICLE_v10015345mg [Citrus clementina] Length = 424 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LSKKLTAM+EL+SCDP YLGK GR+RQRFD +DFD+VP KFNI Sbjct: 382 LSKKLTAMDELISCDPLYLGKAGRERQRFDFDDFDSVPQKFNI 424 >ref|XP_006338677.1| PREDICTED: COP9 signalosome complex subunit 3-like [Solanum tuberosum] Length = 428 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +3 Query: 3 MLSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 ++SKKLT+M+ELMSCDP YLGKVGR+RQRFD +DFD+VP KF + Sbjct: 385 VVSKKLTSMDELMSCDPMYLGKVGRERQRFDFDDFDSVPQKFTV 428 >ref|XP_002300091.1| hypothetical protein POPTR_0001s34180g [Populus trichocarpa] gi|222847349|gb|EEE84896.1| hypothetical protein POPTR_0001s34180g [Populus trichocarpa] Length = 423 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LSKKLTAM+EL+SCDP YL KVGR+RQRFD +DFD VP KFNI Sbjct: 381 LSKKLTAMDELISCDPLYLAKVGRERQRFDFDDFDPVPQKFNI 423 >ref|XP_004231795.1| PREDICTED: COP9 signalosome complex subunit 3-like [Solanum lycopersicum] Length = 428 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 +SKKLT+M+ELMSCDP YLGKVGR+RQRFD +DFD VP KF I Sbjct: 386 VSKKLTSMDELMSCDPMYLGKVGRERQRFDFDDFDGVPQKFTI 428 >ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit 3 [Vitis vinifera] gi|296090247|emb|CBI40066.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LSKKLT M+EL+SCDP YL K GR+RQRFD +D+DTVP KFNI Sbjct: 382 LSKKLTTMDELISCDPLYLAKAGRERQRFDFDDYDTVPQKFNI 424 >ref|XP_004303998.1| PREDICTED: COP9 signalosome complex subunit 3-like [Fragaria vesca subsp. vesca] Length = 421 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LS+KLT MNE +SCDP YL KVGR+RQRFD +D+D VP +FNI Sbjct: 379 LSRKLTTMNENISCDPMYLAKVGRERQRFDFDDYDPVPQRFNI 421 >gb|EXC31360.1| COP9 signalosome complex subunit 3 [Morus notabilis] Length = 443 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LS+KLTAM+E +SCDP YL K GR+R RFDL+D+D+VP KFNI Sbjct: 401 LSRKLTAMDENISCDPLYLSKAGRERPRFDLDDYDSVPQKFNI 443 >gb|EOY02711.1| Proteasome component domain protein [Theobroma cacao] Length = 369 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKF 128 LSKKLT M+ELMSCDP YL K GR+RQR D +DFDTVP K+ Sbjct: 329 LSKKLTVMDELMSCDPLYLAKAGRERQRLDFDDFDTVPQKY 369 >gb|EMJ16636.1| hypothetical protein PRUPE_ppa006197mg [Prunus persica] Length = 423 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LS+KLTAM+E +S D +LGKVGR+RQRFD +DFDTVP KFNI Sbjct: 381 LSRKLTAMDENISSDALFLGKVGRERQRFDFDDFDTVPQKFNI 423 >ref|XP_004159785.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 3-like [Cucumis sativus] Length = 423 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 L+KKLTAM+E +S DP YL K GR+RQRFD +DFD+VP KFNI Sbjct: 381 LTKKLTAMDENISSDPLYLAKAGRERQRFDYDDFDSVPQKFNI 423 >ref|XP_004138469.1| PREDICTED: COP9 signalosome complex subunit 3-like [Cucumis sativus] Length = 423 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 L+KKLTAM+E +S DP YL K GR+RQRFD +DFD+VP KFNI Sbjct: 381 LTKKLTAMDENISSDPLYLAKAGRERQRFDYDDFDSVPQKFNI 423 >ref|NP_568296.1| COP9 signalosome complex subunit 3 [Arabidopsis thaliana] gi|55976552|sp|Q8W575.2|CSN3_ARATH RecName: Full=COP9 signalosome complex subunit 3; Short=Signalosome subunit 3; AltName: Full=Protein FUSCA 11 gi|18056657|gb|AAL58102.1|AF395059_1 CSN complex subunit 3 [Arabidopsis thaliana] gi|14388969|gb|AAK61872.1| COP9 signalosome subunit 3 [Arabidopsis thaliana] gi|14388971|gb|AAK61873.1| COP9 signalosome subunit 3 [Arabidopsis thaliana] gi|21537132|gb|AAM61473.1| unknown [Arabidopsis thaliana] gi|332004622|gb|AED92005.1| COP9 signalosome complex subunit 3 [Arabidopsis thaliana] Length = 429 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDL-EDFDTVPSKFNI 134 LSK L AM+E +SCDP YLGKVGR+RQR+D +DFDTVP KF++ Sbjct: 386 LSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 429 >ref|XP_006287815.1| hypothetical protein CARUB_v10001029mg [Capsella rubella] gi|482556521|gb|EOA20713.1| hypothetical protein CARUB_v10001029mg [Capsella rubella] Length = 425 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDL-EDFDTVPSKFNI 134 LSK L AM+E +SCDP YLGKVGR+RQR+D +DFDTVP KF++ Sbjct: 382 LSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 425 >gb|AAL31917.1|AF419585_1 AT5g14250/F18O22_40 [Arabidopsis thaliana] gi|21360467|gb|AAM47349.1| AT5g14250/F18O22_40 [Arabidopsis thaliana] Length = 429 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDL-EDFDTVPSKFNI 134 LSK L AM+E +SCDP YLGKVGR+RQR+D +DFDTVP KF++ Sbjct: 386 LSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 429 >ref|XP_002871609.1| hypothetical protein ARALYDRAFT_488259 [Arabidopsis lyrata subsp. lyrata] gi|297317446|gb|EFH47868.1| hypothetical protein ARALYDRAFT_488259 [Arabidopsis lyrata subsp. lyrata] Length = 429 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDL-EDFDTVPSKFNI 134 LSK L AM+E +SCDP YLGKVGR+RQR+D +DFDTVP KF++ Sbjct: 386 LSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 429 >emb|CAB87764.1| putative protein [Arabidopsis thaliana] Length = 459 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDL-EDFDTVPSKFNI 134 LSK L AM+E +SCDP YLGKVGR+RQR+D +DFDTVP KF++ Sbjct: 416 LSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 459 >ref|NP_001169045.1| uncharacterized protein LOC100382885 [Zea mays] gi|223974663|gb|ACN31519.1| unknown [Zea mays] Length = 425 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKF 128 LSKKL +++E MSCDPSYL K GRDR RFD +DFD+VP K+ Sbjct: 384 LSKKLASIDENMSCDPSYLLKTGRDRGRFDYDDFDSVPHKY 424 >gb|ESW23538.1| hypothetical protein PHAVU_004G055700g [Phaseolus vulgaris] Length = 422 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 6 LSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKFNI 134 LS+KLTAM+E +SCD YL K GR+RQR+D +DFD VP KFNI Sbjct: 381 LSRKLTAMDEQISCDQLYLSKAGRERQRYDFDDFD-VPQKFNI 422 >ref|XP_006848613.1| hypothetical protein AMTR_s00171p00017320 [Amborella trichopoda] gi|548851964|gb|ERN10194.1| hypothetical protein AMTR_s00171p00017320 [Amborella trichopoda] Length = 376 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = +3 Query: 3 MLSKKLTAMNELMSCDPSYLGKVGRDRQRFDLEDFDTVPSKF 128 +LSKKL+A++E +SCD +YL KVGR+R RF++++FDTVP K+ Sbjct: 332 LLSKKLSAVDEHISCDAAYLSKVGRERPRFEIDEFDTVPQKY 373