BLASTX nr result
ID: Rehmannia26_contig00022121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022121 (642 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359092.1| PREDICTED: heterogeneous nuclear ribonucleop... 68 2e-09 ref|XP_004231546.1| PREDICTED: polyadenylate-binding protein 4-l... 64 5e-08 >ref|XP_006359092.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like [Solanum tuberosum] Length = 424 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = -3 Query: 640 VPPSSIGMQSSGGYPDSGNYGFQSAYPPQPNHPAGPGSRLP---AYQGMPPY 494 +P SS GM SSGGYPD GNYG QS+YP Q P G GSR+P YQGMPPY Sbjct: 373 MPQSSAGMPSSGGYPDGGNYGLQSSYPSQVPQP-GAGSRVPPGGMYQGMPPY 423 >ref|XP_004231546.1| PREDICTED: polyadenylate-binding protein 4-like isoform 1 [Solanum lycopersicum] gi|460371445|ref|XP_004231547.1| PREDICTED: polyadenylate-binding protein 4-like isoform 2 [Solanum lycopersicum] gi|460371447|ref|XP_004231548.1| PREDICTED: polyadenylate-binding protein 4-like isoform 3 [Solanum lycopersicum] gi|460371449|ref|XP_004231549.1| PREDICTED: polyadenylate-binding protein 4-like isoform 4 [Solanum lycopersicum] Length = 424 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = -3 Query: 640 VPPSSIGMQSSGGYPDSGNYGFQSAYPPQPNHPAGPGSRLP---AYQGMPPY 494 +P SS GM SSGG+PD G+Y QSAYP Q P G GSR+P YQGMPPY Sbjct: 373 MPQSSAGMPSSGGFPDGGSYALQSAYPTQVPQP-GAGSRVPPGGMYQGMPPY 423