BLASTX nr result
ID: Rehmannia26_contig00022015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022015 (570 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans]... 137 1e-30 ref|YP_008082624.1| hypothetical chloroplast RF21 (chloroplast) ... 137 1e-30 ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 137 1e-30 ref|YP_004564046.1| Ycf2 protein [Olea woodiana subsp. woodiana]... 137 1e-30 emb|CBR23873.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi... 137 1e-30 ref|YP_004376463.1| Ycf2 protein [Olea europaea subsp. europaea]... 137 1e-30 gb|ADD30879.1| putative RF2 protein [Antirrhinum majus] gi|34080... 137 1e-30 ref|YP_003359401.1| Ycf2 (chloroplast) [Olea europaea] gi|283795... 137 1e-30 ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi... 136 4e-30 ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi... 136 4e-30 gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] 134 2e-29 gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulga... 134 2e-29 ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 134 2e-29 gb|ADD30887.1| putative RF2 protein [Nerium oleander] gi|3408071... 134 2e-29 ref|YP_008815998.1| Ycf2 (chloroplast) [Lindenbergia philippensi... 133 4e-29 ref|YP_008815981.1| Ycf2 (chloroplast) [Lindenbergia philippensi... 133 4e-29 ref|YP_004940552.1| ycf2 gene product (chloroplast) [Boea hygrom... 132 5e-29 gb|AEK71539.1| hypothetical chloroplast RF2 [Phyllanthus calycinus] 132 6e-29 gb|ADD30881.1| putative RF2 protein [Dillenia indica] gi|3408070... 132 6e-29 ref|YP_817526.1| hypothetical chloroplast RF2 [Coffea arabica] g... 132 6e-29 >ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|568247135|ref|YP_008964094.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697199|gb|AHA84954.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697206|gb|AHA84961.1| hypothetical chloroplast RF2 [Ajuga reptans] Length = 2248 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1685 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1744 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1745 VIASTHIP 1752 >ref|YP_008082624.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] gi|519704569|ref|YP_008082645.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] gi|498921897|gb|AGL61118.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] gi|498921919|gb|AGL61140.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] Length = 2271 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1691 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1750 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1751 VIASTHIP 1758 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1721 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1780 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1781 VIASTHIP 1788 >ref|YP_004564046.1| Ycf2 protein [Olea woodiana subsp. woodiana] gi|334701681|ref|YP_004564066.1| Ycf2 protein [Olea woodiana subsp. woodiana] gi|334084701|emb|CBS29394.1| Ycf2 protein [Olea woodiana subsp. woodiana] gi|334084721|emb|CBS29415.1| Ycf2 protein [Olea woodiana subsp. woodiana] Length = 2165 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1659 VIASTHIP 1666 >emb|CBR23873.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334084463|emb|CBR23893.1| Ycf2 protein [Olea europaea subsp. cuspidata] Length = 2165 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1659 VIASTHIP 1666 >ref|YP_004376463.1| Ycf2 protein [Olea europaea subsp. europaea] gi|330850805|ref|YP_004376483.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334700324|ref|YP_004563823.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334700344|ref|YP_004563843.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334701930|ref|YP_004564539.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|334701950|ref|YP_004564559.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|328795475|emb|CBR30357.1| Ycf2 protein [Olea europaea subsp. europaea] gi|328795495|emb|CBR30377.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084529|emb|CBR24666.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084549|emb|CBR24687.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084615|emb|CBR30450.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084635|emb|CBR30471.1| Ycf2 protein [Olea europaea subsp. europaea] gi|334084906|emb|CBS29285.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|334084926|emb|CBS29312.1| Ycf2 protein [Olea europaea subsp. maroccana] gi|334084992|emb|CBJ04340.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334085012|emb|CBJ04360.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334085078|emb|CBR23781.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|334085098|emb|CBR23801.1| Ycf2 protein [Olea europaea subsp. cuspidata] gi|510934446|emb|CCQ09144.1| Ycf2 protein (chloroplast) [Olea europaea subsp. europaea] gi|510934466|emb|CCQ09164.1| Ycf2 prot (chloroplast) [Olea europaea subsp. europaea] Length = 2165 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1599 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1658 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1659 VIASTHIP 1666 >gb|ADD30879.1| putative RF2 protein [Antirrhinum majus] gi|340807055|gb|AEK71663.1| hypothetical chloroplast RF2 [Antirrhinum majus] Length = 2274 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1711 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1770 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1771 VIASTHIP 1778 >ref|YP_003359401.1| Ycf2 (chloroplast) [Olea europaea] gi|283795030|ref|YP_003359421.1| Ycf2 (chloroplast) [Olea europaea] gi|281428729|gb|ADA69968.1| Ycf2 (chloroplast) [Olea europaea] gi|281428749|gb|ADA69988.1| Ycf2 (chloroplast) [Olea europaea] gi|291059296|gb|ADD72132.1| hypothetical chloroplast RF21 [Olea europaea] gi|291059317|gb|ADD72153.1| hypothetical chloroplast RF21 [Olea europaea] Length = 2277 Score = 137 bits (346), Expect = 1e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1711 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1770 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1771 VIASTHIP 1778 >ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi|575882189|emb|CDL78862.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 136 bits (342), Expect = 4e-30 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFEL KAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1700 MMPEIDRFYITLQFELVKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1759 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1760 VIASTHIP 1767 >ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] gi|575882181|emb|CDL78854.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 136 bits (342), Expect = 4e-30 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYITLQFEL KAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL Sbjct: 1700 MMPEIDRFYITLQFELVKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 1759 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1760 VIASTHIP 1767 >gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] Length = 2279 Score = 134 bits (336), Expect = 2e-29 Identities = 67/71 (94%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 502 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS ERCSTR Sbjct: 1710 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSRDCERCSTR 1769 Query: 503 NILVIALTHIP 535 NILVIA THIP Sbjct: 1770 NILVIASTHIP 1780 >gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176216|gb|AFV61875.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 2261 Score = 134 bits (336), Expect = 2e-29 Identities = 64/68 (94%), Positives = 65/68 (95%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYI LQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLL NHLSERCSTRNIL Sbjct: 1695 MMPEIDRFYIILQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLANHLSERCSTRNIL 1754 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1755 VIASTHIP 1762 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|573461995|emb|CCQ71664.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] gi|573462016|emb|CCQ71685.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 134 bits (336), Expect = 2e-29 Identities = 64/68 (94%), Positives = 65/68 (95%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+FYI LQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLL NHLSERCSTRNIL Sbjct: 1717 MMPEIDRFYIILQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLANHLSERCSTRNIL 1776 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1777 VIASTHIP 1784 >gb|ADD30887.1| putative RF2 protein [Nerium oleander] gi|340807172|gb|AEK71765.1| hypothetical chloroplast RF2 [Nerium oleander] Length = 2278 Score = 134 bits (336), Expect = 2e-29 Identities = 67/71 (94%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 502 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS ERCSTR Sbjct: 1709 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSRDCERCSTR 1768 Query: 503 NILVIALTHIP 535 NILVIA THIP Sbjct: 1769 NILVIASTHIP 1779 >ref|YP_008815998.1| Ycf2 (chloroplast) [Lindenbergia philippensis] gi|557136925|emb|CDI43979.1| Ycf2 (chloroplast) [Lindenbergia philippensis] Length = 2274 Score = 133 bits (334), Expect = 4e-29 Identities = 64/68 (94%), Positives = 65/68 (95%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MM EID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLS GLLVNHLSERCSTRNIL Sbjct: 1708 MMSEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSFGLLVNHLSERCSTRNIL 1767 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1768 VIASTHIP 1775 >ref|YP_008815981.1| Ycf2 (chloroplast) [Lindenbergia philippensis] gi|557136908|emb|CDI43962.1| Ycf2 (chloroplast) [Lindenbergia philippensis] Length = 2274 Score = 133 bits (334), Expect = 4e-29 Identities = 64/68 (94%), Positives = 65/68 (95%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MM EID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLS GLLVNHLSERCSTRNIL Sbjct: 1708 MMSEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSFGLLVNHLSERCSTRNIL 1767 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1768 VIASTHIP 1775 >ref|YP_004940552.1| ycf2 gene product (chloroplast) [Boea hygrometrica] gi|364284047|ref|YP_004940572.1| ycf2 gene product (chloroplast) [Boea hygrometrica] gi|340549450|gb|AEK53272.1| hypothetical chloroplast RF21 (chloroplast) [Boea hygrometrica] gi|340549470|gb|AEK53292.1| hypothetical chloroplast RF21 (chloroplast) [Boea hygrometrica] Length = 2274 Score = 132 bits (333), Expect = 5e-29 Identities = 64/68 (94%), Positives = 65/68 (95%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSTRNIL 511 MMPEID+ YITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCS RNIL Sbjct: 1708 MMPEIDRSYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSERCSNRNIL 1767 Query: 512 VIALTHIP 535 VIA THIP Sbjct: 1768 VIASTHIP 1775 >gb|AEK71539.1| hypothetical chloroplast RF2 [Phyllanthus calycinus] Length = 2270 Score = 132 bits (332), Expect = 6e-29 Identities = 66/71 (92%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 502 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS ERCSTR Sbjct: 1701 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSRDCERCSTR 1760 Query: 503 NILVIALTHIP 535 NILVIA THIP Sbjct: 1761 NILVIASTHIP 1771 >gb|ADD30881.1| putative RF2 protein [Dillenia indica] gi|340807063|gb|AEK71670.1| hypothetical chloroplast RF2 [Dillenia indica] Length = 2297 Score = 132 bits (332), Expect = 6e-29 Identities = 66/71 (92%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 502 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS ERCSTR Sbjct: 1731 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSRDCERCSTR 1790 Query: 503 NILVIALTHIP 535 NILVIA THIP Sbjct: 1791 NILVIASTHIP 1801 >ref|YP_817526.1| hypothetical chloroplast RF2 [Coffea arabica] gi|116617170|ref|YP_817543.1| hypothetical chloroplast RF2 [Coffea arabica] gi|122153663|sp|A0A379.1|YCF2_COFAR RecName: Full=Protein Ycf2 gi|116242207|gb|ABJ89722.1| hypothetical chloroplast RF2 [Coffea arabica] gi|116242226|gb|ABJ89741.1| hypothetical chloroplast RF2 [Coffea arabica] Length = 2281 Score = 132 bits (332), Expect = 6e-29 Identities = 66/71 (92%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +2 Query: 332 MMPEIDQFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS---ERCSTR 502 MMPEID+FYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLS ERCSTR Sbjct: 1712 MMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNYLSLGLLVNHLSMDCERCSTR 1771 Query: 503 NILVIALTHIP 535 NILVIA THIP Sbjct: 1772 NILVIASTHIP 1782