BLASTX nr result
ID: Rehmannia26_contig00022002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00022002 (455 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY02645.1| Calcium-binding site, putative [Theobroma cacao] 57 3e-06 >gb|EOY02645.1| Calcium-binding site, putative [Theobroma cacao] Length = 211 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 3 SSSDLGSDYRLITRRLVDGRPGLEFSGFSATSVLDHLGS 119 SS D+ ++YRLIT R+VDGRPGL SGFSAT +LDHL + Sbjct: 87 SSDDMVTNYRLITWRVVDGRPGLNLSGFSATRILDHLAN 125