BLASTX nr result
ID: Rehmannia26_contig00017381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00017381 (429 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523972.1| RNA polymerase sigma factor rpoD1, putative ... 60 3e-07 gb|EPS64499.1| sigma factor, partial [Genlisea aurea] 59 7e-07 ref|XP_002273602.1| PREDICTED: RNA polymerase sigma factor rpoD-... 59 7e-07 ref|XP_006484754.1| PREDICTED: RNA polymerase sigma factor sigB-... 58 1e-06 ref|XP_006437338.1| hypothetical protein CICLE_v10030998mg [Citr... 58 1e-06 >ref|XP_002523972.1| RNA polymerase sigma factor rpoD1, putative [Ricinus communis] gi|223536699|gb|EEF38340.1| RNA polymerase sigma factor rpoD1, putative [Ricinus communis] Length = 569 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +2 Query: 278 MSCLLPQFKCSPDTFAVNFKSQSHAFVN---SSKNRVSINFRTQCILSITS 421 MSCLLPQFKC PDTF+++F++ F N S+K+R I +R QCILS TS Sbjct: 2 MSCLLPQFKCQPDTFSIHFRANYFHFSNVTQSTKSREPIYYRAQCILSTTS 52 >gb|EPS64499.1| sigma factor, partial [Genlisea aurea] Length = 431 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +2 Query: 278 MSCLLPQFKCSPDTFAVNFKSQSHAFVNSSKNRVSINFRTQCILSITSAP 427 MSCL+PQFKC PD FAV F+SQSH +++SK I+F+T C L T P Sbjct: 1 MSCLVPQFKCPPDIFAVKFRSQSH--LHTSKRTEGIDFQTNCALITTPPP 48 >ref|XP_002273602.1| PREDICTED: RNA polymerase sigma factor rpoD-like [Vitis vinifera] Length = 578 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = +2 Query: 278 MSCLLPQFKCSPDTFAVNFKSQSHAFVNSSKNRVSINFRTQCILSITSAP 427 MSCLLPQFKC PDTF+ + K H S KNR +I FR QC LS TS P Sbjct: 1 MSCLLPQFKCPPDTFSTHPK--LHILCKSPKNREAIYFRVQCALSTTSPP 48 >ref|XP_006484754.1| PREDICTED: RNA polymerase sigma factor sigB-like isoform X1 [Citrus sinensis] Length = 605 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/51 (52%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = +2 Query: 278 MSCLLPQFKCSPDTFAVNFK---SQSHAFVNSSKNRVSINFRTQCILSITS 421 MSCLLPQFKC PDTF+++F+ + H + SK++ I FRT C+LS TS Sbjct: 24 MSCLLPQFKCQPDTFSIHFRTLHNHQHHSSHPSKSKEPICFRTHCVLSTTS 74 >ref|XP_006437338.1| hypothetical protein CICLE_v10030998mg [Citrus clementina] gi|557539534|gb|ESR50578.1| hypothetical protein CICLE_v10030998mg [Citrus clementina] Length = 605 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/51 (52%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = +2 Query: 278 MSCLLPQFKCSPDTFAVNFK---SQSHAFVNSSKNRVSINFRTQCILSITS 421 MSCLLPQFKC PDTF+++F+ + H + SK++ I FRT C+LS TS Sbjct: 24 MSCLLPQFKCQPDTFSIHFRTLHNHQHHSSHPSKSKEPICFRTHCVLSTTS 74