BLASTX nr result
ID: Rehmannia26_contig00017218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00017218 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64442.1| hypothetical protein M569_10338, partial [Genlise... 59 7e-07 >gb|EPS64442.1| hypothetical protein M569_10338, partial [Genlisea aurea] Length = 679 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +1 Query: 1 TWKKRVEAEMMSVDARYG*TRALSAWPS*SRLL-AASRGANRTRSGYDVAIKSSIT 165 TWKKRVEAEM++ + + G T+A+S WPS SR AA RT +G DVA+KSSIT Sbjct: 428 TWKKRVEAEMITNEEKSGSTQAVSGWPSKSRAAEAAPHSGGRTPTGSDVAMKSSIT 483