BLASTX nr result
ID: Rehmannia26_contig00017149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00017149 (524 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD17398.1| putative non-LTR retroelement reverse transcripta... 60 2e-07 gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-... 55 7e-06 >gb|AAD17398.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1225 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 1/98 (1%) Frame = -3 Query: 516 CGAAEETLEHLLFTCERAVKAWRLSPVWWSEGVSP-NCSVRQWWGNLCLGFWDKVFQDRV 340 CGA EE++ HLLF C + + W LSP+ SE + P N + L G + +D + Sbjct: 967 CGAEEESINHLLFLCPPSRQIWALSPIPSSEYIFPRNSLFYNFDFLLSRGKEFDIAEDIM 1026 Query: 339 QLSTYILWWLWKTRNSWMFEGRVTSELDTVSLAWTEWN 226 ++ +ILW++WK+RN ++FE + S + A E N Sbjct: 1027 EIFPWILWYIWKSRNRFIFENVIESPQVILDFAIQEAN 1064 >gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana] Length = 1142 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 5/103 (4%) Frame = -3 Query: 516 CGAAEETLEHLLFTCERAVKAWRLSPVWWSEGVSPNCSVRQWWGNLCLGFWDKVFQDRVQ 337 CGA+EE++ H LF C A + W LS + + G+ P+ S+ + NL FW V Sbjct: 869 CGASEESINHTLFQCHPARQIWALSQIPTAPGIFPSNSI---FTNLDHLFWR--IPSGVD 923 Query: 336 LSTY--ILWWLWKTRNSWMFEGRVTSELDTVSLAWTE---WNE 223 + Y I+W++WK RN +FE ++ + LA E W E Sbjct: 924 SAPYPWIIWYIWKARNEKVFENVDKDPMEILLLAVKEAQSWQE 966