BLASTX nr result
ID: Rehmannia26_contig00017047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00017047 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71578.1| hypothetical protein M569_03176, partial [Genlise... 62 1e-07 gb|EMJ16556.1| hypothetical protein PRUPE_ppa005522mg [Prunus pe... 61 1e-07 ref|NP_001241986.1| uncharacterized protein LOC100782876 precurs... 61 1e-07 gb|ESW11428.1| hypothetical protein PHAVU_008G029100g, partial [... 61 2e-07 gb|ESW11427.1| hypothetical protein PHAVU_008G029100g [Phaseolus... 61 2e-07 ref|XP_004491893.1| PREDICTED: protein COBRA-like [Cicer arietinum] 61 2e-07 gb|AFZ78568.1| COBRA-like protein [Populus tomentosa] 61 2e-07 ref|XP_002305390.1| phytochelatin synthetase family protein [Pop... 61 2e-07 gb|AAR13304.1| phytochelatin synthetase-like protein [Phaseolus ... 61 2e-07 ref|XP_006440798.1| hypothetical protein CICLE_v10020097mg [Citr... 60 2e-07 ref|XP_004958241.1| PREDICTED: COBRA-like protein 1-like [Setari... 60 2e-07 gb|EMJ09986.1| hypothetical protein PRUPE_ppa024172mg [Prunus pe... 60 2e-07 ref|XP_002264600.1| PREDICTED: protein COBRA [Vitis vinifera] gi... 60 3e-07 ref|XP_003552600.1| PREDICTED: protein COBRA-like [Glycine max] 60 4e-07 gb|EOY22118.1| COBRA-like extracellular glycosyl-phosphatidyl in... 59 5e-07 gb|EOY22117.1| COBRA-like extracellular glycosyl-phosphatidyl in... 59 5e-07 ref|XP_002531000.1| Protein COBRA precursor, putative [Ricinus c... 59 5e-07 gb|EAZ04637.1| hypothetical protein OsI_26785 [Oryza sativa Indi... 59 5e-07 ref|XP_006658783.1| PREDICTED: COBRA-like protein 1-like [Oryza ... 59 7e-07 ref|XP_006477706.1| PREDICTED: protein COBRA-like [Citrus sinensis] 59 7e-07 >gb|EPS71578.1| hypothetical protein M569_03176, partial [Genlisea aurea] Length = 433 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYPYLPNSS + V Sbjct: 390 RRIYFNGDNCVMPPPDAYPYLPNSSWSKRV 419 >gb|EMJ16556.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica] Length = 456 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQ 240 RRIYFNGDNCVMPPPDAYP+LPNS RQ Sbjct: 407 RRIYFNGDNCVMPPPDAYPWLPNSGFRQ 434 >ref|NP_001241986.1| uncharacterized protein LOC100782876 precursor [Glycine max] gi|255642010|gb|ACU21272.1| unknown [Glycine max] Length = 448 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYP+LPN+ RQ V Sbjct: 400 RRIYFNGDNCVMPPPDAYPWLPNAGARQEV 429 >gb|ESW11428.1| hypothetical protein PHAVU_008G029100g, partial [Phaseolus vulgaris] Length = 474 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYP+LPN+ RQ V Sbjct: 426 RRIYFNGDNCVMPPPDAYPWLPNAGSRQEV 455 >gb|ESW11427.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris] Length = 390 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYP+LPN+ RQ V Sbjct: 342 RRIYFNGDNCVMPPPDAYPWLPNAGSRQEV 371 >ref|XP_004491893.1| PREDICTED: protein COBRA-like [Cicer arietinum] Length = 446 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYP+LPN+ RQ V Sbjct: 398 RRIYFNGDNCVMPPPDAYPWLPNTGSRQEV 427 >gb|AFZ78568.1| COBRA-like protein [Populus tomentosa] Length = 453 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQ 240 RRIYFNGDNCVMPPPDAYP+LPN+S RQ Sbjct: 404 RRIYFNGDNCVMPPPDAYPWLPNASSRQ 431 >ref|XP_002305390.1| phytochelatin synthetase family protein [Populus trichocarpa] gi|222848354|gb|EEE85901.1| phytochelatin synthetase family protein [Populus trichocarpa] Length = 453 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQ 240 RRIYFNGDNCVMPPPDAYP+LPN+S RQ Sbjct: 404 RRIYFNGDNCVMPPPDAYPWLPNASSRQ 431 >gb|AAR13304.1| phytochelatin synthetase-like protein [Phaseolus vulgaris] gi|561012568|gb|ESW11429.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris] Length = 448 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYP+LPN+ RQ V Sbjct: 400 RRIYFNGDNCVMPPPDAYPWLPNAGSRQEV 429 >ref|XP_006440798.1| hypothetical protein CICLE_v10020097mg [Citrus clementina] gi|557543060|gb|ESR54038.1| hypothetical protein CICLE_v10020097mg [Citrus clementina] Length = 456 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNVXXXXXXXXXXXXLAITFACV 174 RRIYFNGDNCVMPPPDAYP+LPN+S R + + ACV Sbjct: 407 RRIYFNGDNCVMPPPDAYPWLPNASSRPVISLLRSAIIILASWVLLLACV 456 >ref|XP_004958241.1| PREDICTED: COBRA-like protein 1-like [Setaria italica] Length = 452 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQN 237 RR+YFNGDNCVMPPPDAYP+LPN+S RQ+ Sbjct: 403 RRVYFNGDNCVMPPPDAYPWLPNASPRQS 431 >gb|EMJ09986.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica] Length = 447 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQ 240 RRIYFNGDNCVMPPPDAYP+LPNSS +Q Sbjct: 398 RRIYFNGDNCVMPPPDAYPWLPNSSPKQ 425 >ref|XP_002264600.1| PREDICTED: protein COBRA [Vitis vinifera] gi|297734083|emb|CBI15330.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RRIYFNGDNCVMPPPDAYP+LPN+S R V Sbjct: 407 RRIYFNGDNCVMPPPDAYPWLPNASSRPTV 436 >ref|XP_003552600.1| PREDICTED: protein COBRA-like [Glycine max] Length = 448 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQNV 234 RR+YFNGDNCVMPPPD+YP+LPN+ RQ V Sbjct: 400 RRVYFNGDNCVMPPPDSYPWLPNAGARQEV 429 >gb|EOY22118.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family isoform 2 [Theobroma cacao] Length = 456 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLR 243 RRIYFNGDNCVMPPPDAYP+LPNS R Sbjct: 407 RRIYFNGDNCVMPPPDAYPWLPNSGFR 433 >gb|EOY22117.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family isoform 1 [Theobroma cacao] Length = 475 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLR 243 RRIYFNGDNCVMPPPDAYP+LPNS R Sbjct: 426 RRIYFNGDNCVMPPPDAYPWLPNSGFR 452 >ref|XP_002531000.1| Protein COBRA precursor, putative [Ricinus communis] gi|223529427|gb|EEF31388.1| Protein COBRA precursor, putative [Ricinus communis] Length = 456 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLRQ 240 RRIYFNGDNCVMPPPDAYP+LPN+ RQ Sbjct: 404 RRIYFNGDNCVMPPPDAYPWLPNAGSRQ 431 >gb|EAZ04637.1| hypothetical protein OsI_26785 [Oryza sativa Indica Group] Length = 446 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLR 243 RRIYFNGDNCVMPPPDAYP+LPN+S R Sbjct: 397 RRIYFNGDNCVMPPPDAYPWLPNASTR 423 >ref|XP_006658783.1| PREDICTED: COBRA-like protein 1-like [Oryza brachyantha] Length = 448 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLR 243 RRIYFNGDNCVMPPPDAYP+LPN+S R Sbjct: 399 RRIYFNGDNCVMPPPDAYPWLPNASSR 425 >ref|XP_006477706.1| PREDICTED: protein COBRA-like [Citrus sinensis] Length = 456 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 323 RRIYFNGDNCVMPPPDAYPYLPNSSLR 243 RRIYFNGDNCVMPPPDAYP+LPN+S R Sbjct: 407 RRIYFNGDNCVMPPPDAYPWLPNASSR 433