BLASTX nr result
ID: Rehmannia26_contig00016028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00016028 (403 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea] 59 7e-07 >gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea] Length = 198 Score = 58.9 bits (141), Expect = 7e-07 Identities = 38/115 (33%), Positives = 53/115 (46%), Gaps = 2/115 (1%) Frame = -2 Query: 339 LGGVNSPPPTTMPTK--ESPPPVETLDSDFXXXXXXXXXXXXXXXXXXXXARCDWIRRIT 166 +G ++ PPP + K E PP ++ +D+DF ARC WIRR+ Sbjct: 9 VGAISPPPPESSSQKPAEVPPAMQAMDADFVVILAAMLCALICVLGLIAVARCAWIRRLG 68 Query: 165 GRISTSVPSSEPPRSVANXXXXXXXXXXXXXLTYGEDEDQAEKLSECAICLAEFA 1 G S SS P + AN T+ ED A KLS+CAICL++F+ Sbjct: 69 G--GESAASSLP--AAANKGLKKKVLNSLPKTTFAEDSKLAAKLSDCAICLSDFS 119