BLASTX nr result
ID: Rehmannia26_contig00015764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00015764 (463 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlise... 61 1e-07 >gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlisea aurea] Length = 239 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +3 Query: 315 QLQFRSGISGPKHGE-MGFGFDEIHGPISGPPETDNSSFTALLELPPPQA 461 + QFRS PK GE MGF DEI G IS PPET++SSFTALLELPPP+A Sbjct: 7 EAQFRSA---PKDGEEMGFVLDEIQGLISVPPETESSSFTALLELPPPKA 53